KEGG   Streptomyces coelicolor: SCO5356Help
Entry
SCO5356           CDS       T00085                                 

Gene name
SCBAC5H2.25, thrB
Definition
(RefSeq) homoserine kinase
  KO
K00872  
homoserine kinase [EC:2.7.1.39]
Organism
sco  Streptomyces coelicolor
Pathway
Glycine, serine and threonine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SCO5356 (SCBAC5H2.25)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCO5356 (SCBAC5H2.25)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.39  homoserine kinase
     SCO5356 (SCBAC5H2.25)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
5824855..5825784
Genome map
AA seq 309 aa AA seqDB search
MAGPAFRAAAVRVRVPATSANLGPGFDALGLALGLYDDVVVRVADSGLHIDIAGEGSETL
PRDEKHLLVRSLRTAFDLLGGQPRGLEIVCANRIPHGRGLGSSSAAICAGIVAARAVTIG
GEARLDDAALLDLATEIEGHPDNVAACLLGGFTLSWMESGAARAIRMEPSDSIVPVVFVP
GKPVLTQTARGLLPRSVPHVDAAANAGRAALLVEALTRRPELLLPATEDRLHQEYRAPAM
PESTALVERLRGDGIPAVISGAGPTVMALADADTADKVEALAGTDWAANRLGLDQQGATV
LPLATASDT
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggccggtccagcgttccgcgccgccgccgtcagggtgcgcgtccccgccaccagcgcc
aacctcggtccgggcttcgacgccctgggcctcgcgctgggtctgtacgacgacgtggtc
gtccgggtggccgactccgggctgcacatcgacatcgcgggtgagggcagcgagaccctt
ccgcgcgacgagaagcacctcctcgtccgctccctgcgcaccgccttcgacctgctcggc
gggcagccgcgcggcctggagatcgtctgcgccaaccgcatcccgcacggccgcggcctc
ggctcctcctctgccgccatctgcgccggaatcgtcgccgcgcgcgccgtgacgataggc
ggcgaggcccgcctcgacgacgccgcgctgctcgacctcgccaccgagatcgagggccac
cccgacaacgtggcggcctgtctcctgggcggattcaccctttcctggatggagtccggc
gccgcccgggcgatcaggatggagccctccgattccatcgttccggtggttttcgtgccc
ggaaagccggtactgacccagaccgcgcgcgggctgctcccgcgcagcgttccgcacgtc
gacgccgccgccaacgccggccgcgccgcgctgctcgtcgaggccctcaccaggcgcccc
gagctgctgctgccggccaccgaggaccgcctgcaccaggagtaccgcgcgccggccatg
ccggagagcacggcgctggtggaaaggctgcgtggcgacggcattcccgcggtgatctcg
ggtgccggacccacggtgatggcactggccgacgccgacacggccgacaaggtcgaggcg
ctggccggaacggactgggcggccaaccggctcggcctggaccagcagggcgcgaccgtc
ctgcccctggcgaccgccagcgacacctga

DBGET integrated database retrieval system