KEGG   Streptomyces coelicolor: SCO5366Help
Entry
SCO5366           CDS       T00085                                 

Gene name
2SC6G5.10, atpI
Definition
(RefSeq) ATP synthase I
  KO
K02116  
ATP synthase protein I
Organism
sco  Streptomyces coelicolor
Brite
Photosynthesis proteins [BR:sco00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   SCO5366 (2SC6G5.10)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
5836773..5837207
Genome map
AA seq 144 aa AA seqDB search
MPSNDVRILLQAAVPAAAVGAVAAVVSAVVAGGKGAVGAVVATVLAMLFMGIGLYVLQRT
AKSLPHLFQAMGLMLYAAQILLLFVFLAAFKNTTLFNPRSFAVSLLVVTLAWIAAQTRAH
MKAKVLYVEPEPTGEKPEKTGHSS
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgccgtccaatgacgtccggatcctgcttcaggctgccgtgcccgcggctgccgtcggc
gctgtagccgccgtcgtcagcgccgtggtcgccggcggcaagggggcggtcggagccgtc
gtcgcgaccgtgctcgcgatgctcttcatgggaatcggcctctacgtcctgcagcgcacc
gccaagtcgcttccgcaccttttccaggcgatgggcctgatgctctacgcggcacagatc
ctgctgctgttcgtcttcctcgccgcgttcaagaacacgacgctgttcaacccccgttcc
ttcgcggtcagtctgctcgtcgtcacgctcgcgtggatcgccgcgcagacgcgggcgcac
atgaaggccaaggttctctacgtcgagcccgaaccgacgggcgaaaagcccgaaaagacg
ggccactcgtcgtga

DBGET integrated database retrieval system