KEGG   Streptomyces coelicolor: SCO5385Help
Entry
SCO5385           CDS       T00085                                 

Gene name
2SC6G5.29
Definition
(RefSeq) 3-hydroxybutyryl-CoA dehydrogenase
  KO
K00074  
3-hydroxybutyryl-CoA dehydrogenase [EC:1.1.1.157]
Organism
sco  Streptomyces coelicolor
Pathway
Phenylalanine metabolism
Benzoate degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    SCO5385 (2SC6G5.29)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    SCO5385 (2SC6G5.29)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SCO5385 (2SC6G5.29)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.157  3-hydroxybutyryl-CoA dehydrogenase
     SCO5385 (2SC6G5.29)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
5853124..5853972
Genome map
AA seq 282 aa AA seqDB search
MARKLAVIGAGLMGSGIAQVSAQAGWEVVLRDVTDEALRRGTDGIRASYDKFVAKGRLDA
DDAEAALGRITATTDLDAAADADVVVEAVFEKLEVKHEIFRTLDKLVKDGAILASNTSAI
PITKIAAVTERPERVVGTHFFSPVPMMQLCELVRGYKTSDETLATAREFAESTGKTCIVV
NRDVAGFVTTRLISALVVEAAKLYESGVATAEDIDLACKLGFGHAMGPLATADLTGVDIL
LHATGNIYTESQDEKFAPPELMRRMVDAGDIGRKSGQGFYKH
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
gtggcacggaagctcgccgtcatcggagccggtctcatggggtccggcatcgcccaggtc
tccgcccaggcgggctgggaggtcgtcctgcgcgacgtcaccgacgaggcgttgcggcgc
ggcaccgacggcatcagggcctcctacgacaagttcgtcgccaagggcaggctcgacgcc
gacgacgccgaggccgcgctcgggcgcatcaccgcgaccaccgacctggacgccgccgcc
gacgcggacgtcgtcgtcgaggccgtcttcgagaagctggaagtcaagcacgagatcttc
cgtaccctggacaagctggtgaaggacggggcgatcctcgcgtccaacacctccgccatc
ccgatcaccaagatcgcggccgtgacggagcgccccgagcgggtcgtcggcacccacttc
ttctcaccggtgccgatgatgcagctgtgcgagctggtgcgcggctacaagaccagcgac
gaaacgctcgccaccgcacgcgagttcgccgagtccaccggcaagacctgcatcgtcgtc
aatcgcgacgtcgccgggttcgtgaccacccggctcatctccgccctcgtcgtcgaggcc
gcgaagctgtacgagtcgggcgtcgccaccgccgaggacatcgacctcgcctgcaagctg
ggcttcggccacgccatgggacccctggccaccgccgacctgacgggcgtcgacatcctg
ctgcacgccaccggcaacatctacaccgagtcccaggacgagaagttcgccccgccggag
ctgatgcgccggatggtggacgccggtgacatcggccgcaagagcgggcagggcttctac
aagcactga

DBGET integrated database retrieval system