KEGG   Streptomyces coelicolor: SCO5423Help
Entry
SCO5423           CDS       T00085                                 

Gene name
pyk2, SC8F4.27c
Definition
(RefSeq) pyruvate kinase
  KO
K00873  
pyruvate kinase [EC:2.7.1.40]
Organism
sco  Streptomyces coelicolor
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCO5423 (pyk2)
   01230 Biosynthesis of amino acids
    SCO5423 (pyk2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCO5423 (pyk2)
   00620 Pyruvate metabolism
    SCO5423 (pyk2)
  Nucleotide metabolism
   00230 Purine metabolism
    SCO5423 (pyk2)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     SCO5423 (pyk2)
Exosome [BR:sco04147]
 Exosomal proteins
  Proteins found in most exosomes
   SCO5423 (pyk2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(5892975..5894405)
Genome map
AA seq 476 aa AA seqDB search
MRRSKIVCTLGPAVDSHEQLVTLIEAGMNVARFNFSHGTHAEHQGRYDRVRAAAKETGRA
IGVLADLQGPKIRLETFAEGPVELVRGDEFTITAEDVPGDRTICGTTYKGLPGDVTKGDQ
VLINDGNVELKVTEVEGPRVKTIVIEGGVISDHKGINLPGAAVNVPALSEKDVEDLRFAL
RMGCDLVALSFVRDAKDVADVHRVMDEEGRRVPVIAKVEKPQAVDNMEDVVMAFDGVMVA
RGDLAVEYPLEKVPMVQKRLIELCRRNAKPVIVATQMMESMITNSRPTRAEASDVANAIL
DGADAVMLSAESSVGAYPIETVKTMSKIVTAAEQELLSKGLQPLVPGKKPRTQGGSVARA
AAEIADFLGGKGLVAFTQSGDTARRLSRYRAAQPILAFTTDESTRNQLALSWGVEPHVVP
FVNTTDEMVDLVDQETARLGRFSDGDTVVITAGSPPGVSGTTNMVRVLHLGETRRG
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgttcgaaaatcgtctgtactctcggccccgcggtcgactcccacgagcagctc
gtcacgctgatcgaagccggcatgaacgtggcccgcttcaacttcagccatggcacccac
gccgagcaccagggtcgttacgaccgggtccgggccgccgccaaggagaccggccgggcc
atcggcgtcctcgccgacctccagggcccgaagatccgcctggagaccttcgcggagggc
cccgtcgagctggtgcgcggtgacgagttcaccatcaccgccgaggacgtcccgggcgac
aggacgatctgcggcacgacctacaagggcctgcccggtgacgtcaccaagggcgaccag
gtgctcatcaacgacggcaacgtcgagctgaaggtcaccgaggtcgagggcccccgggtg
aagacgatcgtcatcgagggcggcgtcatctccgaccacaagggcatcaacctgccgggc
gcggcggtcaacgtccccgcgctgagcgagaaggacgtcgaggacctccggttcgcgctg
cgcatgggctgcgacctggtcgccctctccttcgtccgggacgccaaggacgtcgccgac
gtgcaccgcgtcatggacgaggagggccgccgggtcccggtgatcgccaaggtcgagaag
ccccaggcggtcgacaacatggaggacgtcgtgatggcgttcgacggcgtgatggtcgcc
cgtggcgacctggccgtcgagtacccgctcgagaaggtccccatggtgcagaagcgcctg
atcgagctgtgccggcgcaacgccaagccggtgatcgtggcgacccagatgatggagtcg
atgatcacgaactcccggccgacccgcgccgaggcctccgacgtggccaacgcgatcctg
gacggcgccgacgcggtcatgctgtccgccgagtcgagcgtgggcgcctacccgatcgag
accgtcaagacgatgtcgaagatcgtcaccgccgccgagcaggagctgctctccaagggc
ctccagccgctggtgccgggcaagaagccgcgcacgcagggcggttcggtggcccgtgcg
gccgccgagatcgccgacttcctgggcggcaagggcctggtcgccttcacccagtccggc
gacaccgcccgccggctctcccgctatcgcgcggcccagccgatcctcgccttcaccacc
gacgagtccacccgcaaccagctggcgctcagctggggagtggagccgcacgtggtgccg
ttcgtgaacaccacggacgagatggtggacctggtggaccaggagacggcccgcctcggc
cggttcagcgacggcgacaccgtcgtgatcaccgccggttcgccccccggcgtgtccggc
accaccaacatggtgcgggtcctccacctgggcgagacacggcgcggctga

DBGET integrated database retrieval system