KEGG   Streptomyces coelicolor: SCO5424Help
Entry
SCO5424           CDS       T00085                                 

Gene name
ackA, SC8F4.28c
Definition
(RefSeq) acetate kinase
  KO
K00925  
acetate kinase [EC:2.7.2.1]
Organism
sco  Streptomyces coelicolor
Pathway
Taurine and hypotaurine metabolism
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:sco00001]
   00620 Pyruvate metabolism
    SCO5424 (ackA)
   00640 Propanoate metabolism
    SCO5424 (ackA)
  Energy metabolism
   00680 Methane metabolism
    SCO5424 (ackA)
  Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    SCO5424 (ackA)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     SCO5424 (ackA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(5894480..5895703)
Genome map
AA seq 407 aa AA seqDB search
MSSTRVLVLNSGSSSVKYQLIDMRDGERLAAGLVERIGERTSRLRHTLVAAGDTREQEGP
IADHEAALKAVAAELGRDGLGLDSPELAAIGHRVVHGGEFFSEPTLIDENVLTEIERLIP
VAPLHNPANLTGIRTAQALRPDLPQVAVFDTAFHTTMPESAARYAIDPKIADRYRIRRYG
FHGTSHAYVSRETARLLGRAPGDVNVIVLHLGNGASASAVRGGRCVDTSMGLTPLEGLVM
GTRSGDMDPAVIFHLMRVGGMSADEIDTLLNKRSGLFGLCGDNDMREIRRRVDEDDEQAG
LAFDIYIHRLKKYIGAYYAVLGRVDAVAFTAGVGENSAPVREAAVAGLEGLGLAVDGGLN
AVRGDGARLISPAGARVAVAVVPTDEEMEIATQTYALVSESGNPDLT
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
gtgagctccacgcgtgtcctcgtcctcaactccggctcctcgtcggtgaagtaccagctg
atcgacatgcgcgacggggagcggctggcggccgggctggtcgagcgcatcggtgagcgg
acgtcgcggctgaggcacaccctcgtggccgccggcgacacccgggagcaggagggcccg
atcgccgaccacgaggccgccctgaaggcggtcgccgccgagctgggccgggacggtctg
ggcctggactccccggagctggccgcgatcgggcaccgcgtggtgcacggcggcgagttc
ttcagcgagcccaccctgatcgacgagaacgtgctcacggagatcgagcggctgatcccg
gtcgcgccgctgcacaacccggccaacctcaccggcatccgcaccgcgcaggcgctccgt
cccgacctgccgcaggtggcggtcttcgacaccgcgttccacaccacgatgccggagtcc
gcggcgcgctacgcgatcgacccgaagatcgccgaccggtaccgcatccgccgctacggc
ttccacggcacctcgcacgcgtacgtctcccgcgagaccgcgcggctgctgggcagggcg
ccgggcgacgtgaacgtgatcgtgctgcacctgggcaacggggcgtccgcctcggccgtg
cggggcggccggtgcgtggacacctccatgggcctgacgcccttggaaggactcgtgatg
ggtacgcgctcgggagacatggacccggccgtcatcttccatttgatgcgcgttggcgga
atgtccgccgacgagatcgacactcttctcaacaagaggagcggtctgttcggtctgtgc
ggtgacaacgacatgcgggagatccgccgccgggtggacgaggacgacgagcaggcgggg
ctggccttcgacatctacattcaccggctcaagaagtacatcggcgcctattacgccgtt
ctcggacgcgtggacgccgtggcgttcacggcgggggtcggggagaactcggcacccgtg
cgcgaggcggccgtggccggactggaggggctcggcctggcggtcgacggcgggctgaac
gccgtacgcggcgacggagcccggctgatctcgcccgcgggggcgcgggtggccgtggcg
gtggtaccgacggacgaggaaatggagatcgcgacacagacctacgcgctggtaagtgaa
tcggggaatcccgatctcacctga

DBGET integrated database retrieval system