KEGG   Streptomyces coelicolor: SCO5424Help
Entry
SCO5424           CDS       T00085                                 

Gene name
ackA, SC8F4.28c
Definition
(RefSeq) acetate kinase
  KO
K00925  
acetate kinase [EC:2.7.2.1]
Organism
sco  Streptomyces coelicolor
Pathway
Taurine and hypotaurine metabolism
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCO5424 (ackA)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SCO5424 (ackA)
   00640 Propanoate metabolism
    SCO5424 (ackA)
  Energy metabolism
   00680 Methane metabolism
    SCO5424 (ackA)
  Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    SCO5424 (ackA)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     SCO5424 (ackA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(5894480..5895703)
Genome map
AA seq 407 aa AA seqDB search
MSSTRVLVLNSGSSSVKYQLIDMRDGERLAAGLVERIGERTSRLRHTLVAAGDTREQEGP
IADHEAALKAVAAELGRDGLGLDSPELAAIGHRVVHGGEFFSEPTLIDENVLTEIERLIP
VAPLHNPANLTGIRTAQALRPDLPQVAVFDTAFHTTMPESAARYAIDPKIADRYRIRRYG
FHGTSHAYVSRETARLLGRAPGDVNVIVLHLGNGASASAVRGGRCVDTSMGLTPLEGLVM
GTRSGDMDPAVIFHLMRVGGMSADEIDTLLNKRSGLFGLCGDNDMREIRRRVDEDDEQAG
LAFDIYIHRLKKYIGAYYAVLGRVDAVAFTAGVGENSAPVREAAVAGLEGLGLAVDGGLN
AVRGDGARLISPAGARVAVAVVPTDEEMEIATQTYALVSESGNPDLT
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
gtgagctccacgcgtgtcctcgtcctcaactccggctcctcgtcggtgaagtaccagctg
atcgacatgcgcgacggggagcggctggcggccgggctggtcgagcgcatcggtgagcgg
acgtcgcggctgaggcacaccctcgtggccgccggcgacacccgggagcaggagggcccg
atcgccgaccacgaggccgccctgaaggcggtcgccgccgagctgggccgggacggtctg
ggcctggactccccggagctggccgcgatcgggcaccgcgtggtgcacggcggcgagttc
ttcagcgagcccaccctgatcgacgagaacgtgctcacggagatcgagcggctgatcccg
gtcgcgccgctgcacaacccggccaacctcaccggcatccgcaccgcgcaggcgctccgt
cccgacctgccgcaggtggcggtcttcgacaccgcgttccacaccacgatgccggagtcc
gcggcgcgctacgcgatcgacccgaagatcgccgaccggtaccgcatccgccgctacggc
ttccacggcacctcgcacgcgtacgtctcccgcgagaccgcgcggctgctgggcagggcg
ccgggcgacgtgaacgtgatcgtgctgcacctgggcaacggggcgtccgcctcggccgtg
cggggcggccggtgcgtggacacctccatgggcctgacgcccttggaaggactcgtgatg
ggtacgcgctcgggagacatggacccggccgtcatcttccatttgatgcgcgttggcgga
atgtccgccgacgagatcgacactcttctcaacaagaggagcggtctgttcggtctgtgc
ggtgacaacgacatgcgggagatccgccgccgggtggacgaggacgacgagcaggcgggg
ctggccttcgacatctacattcaccggctcaagaagtacatcggcgcctattacgccgtt
ctcggacgcgtggacgccgtggcgttcacggcgggggtcggggagaactcggcacccgtg
cgcgaggcggccgtggccggactggaggggctcggcctggcggtcgacggcgggctgaac
gccgtacgcggcgacggagcccggctgatctcgcccgcgggggcgcgggtggccgtggcg
gtggtaccgacggacgaggaaatggagatcgcgacacagacctacgcgctggtaagtgaa
tcggggaatcccgatctcacctga

DBGET integrated database retrieval system