KEGG   Streptomyces coelicolor: SCO5425Help
Entry
SCO5425           CDS       T00085                                 

Gene name
pta, SC6A11.01c, SC8F4.29c
Definition
(RefSeq) phosphate acetyltransferase
  KO
K13788  
phosphate acetyltransferase [EC:2.3.1.8]
Organism
sco  Streptomyces coelicolor
Pathway
Taurine and hypotaurine metabolism
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:sco00001]
   00620 Pyruvate metabolism
    SCO5425 (pta)
   00640 Propanoate metabolism
    SCO5425 (pta)
  Energy metabolism
   00680 Methane metabolism
    SCO5425 (pta)
  Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    SCO5425 (pta)
Enzymes [BR:sco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.8  phosphate acetyltransferase
     SCO5425 (pta)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(5895700..5897793)
Genome map
AA seq 697 aa AA seqDB search
MTRSVYVTGIDRGDGRQVVELGVMELLTRQVDRVGVFRPLVHDGPDRLFELLRARYRLSQ
DPATVYGMDYQEASLLQAEQGVDELVSALVDRFHLVARDYDVVLVLGTDYADTQFPDELS
LNARLANEFGASVLPVVGGRKQTADSVLAETHNAFRAYDGLGCDVLAMVTNRVAREDRDE
IAERLAHRLPVPCWVVPDEPALSAPTVSQIAHALGAEIVLGDDSGLARDALDFVFGGAML
PNLLAALTPGCLVITPGDRADLVIGTLAAHSAGTPPIAGVLLTLNEVPGEGILTLAARLA
PGTPVLSVTGTSFPTAERLFSLEGKLGAATPRKAETALGLFERYVDTAELNKRVSAPSSD
RVTPMMFEHKLLEQARSDLRRVVLPEGTEERVLHAAEVLLRRGVCELTLLGPVEQIRKKA
ADLGIDLGGAELIDPAASELRDSFAEKYAALRAHKGVTVELAYDVVSDVNYFGTLMVQEG
FADGMVSGSVHSTAATIRPAFEIIKTKPDAAIVSSVFFMCLADKVLVYGDCAVNPDPDAE
QLADIATQSASTAAQFGVEPRIAMLSYSTGTSGSGADVDKVREATELVRSRRPDLSVEGP
IQYDAAVEPSVAATKLPGSAVAGQASVLIFPDLNTGNNTYKAVQRSAGAIAVGPVLQGLR
KPVNDLSRGALVQDIVNTVAITAIQAQQSPTEKASAQ
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcgcagcgtgtacgtgaccggcatcgaccgcggcgacggccgccaggtcgtcgag
ctgggggtcatggaactgctgacccggcaggtcgaccgggtcggcgtcttccgtcccctg
gtgcacgacgggccggaccggctcttcgaactgctgcgcgcccgctaccggctctcgcag
gaccccgcgacggtctacggcatggactaccaggaggcctccctcctccaggcggaacag
ggcgtggacgagctggtgtccgcgctggtcgaccgcttccacctggtcgcgcgggactac
gacgtcgtcctggtcctgggcaccgactacgccgacacccagttcccggacgagctgtcc
ctgaacgcgcggctcgccaacgagttcggcgcctcggtcctccccgtcgtcgggggccgc
aagcagaccgccgactcggtgctggccgagacccacaacgccttccgtgcctacgacggc
ctcggctgcgacgtgctcgccatggtgaccaaccgggtcgcgcgcgaggaccgggacgag
atcgccgagcggctcgcgcaccggctgccggtgccgtgctgggtggtaccggacgagccc
gccctgtcggcgccgacggtctcccagatcgcgcacgccctgggcgccgagatcgtcctc
ggcgacgactccgggctcgcccgcgacgcgctggacttcgtcttcggcggggccatgctg
cccaacctgctggccgcgctgaccccgggctgcctggtcatcacgcccggcgaccgcgcc
gacctggtgatcggcacgctggccgcgcacagcgccggcaccccgccgatagccggggtg
ctgctgacgctgaacgaggtgcccggcgagggcatcctcaccctcgccgcccggctggcc
cccggcacgccggtgctctcggtgacgggcaccagctttcccaccgcggaacggctcttc
tccctggagggcaagctgggcgcggccaccccgcgcaaggcggagaccgccctcggcctc
ttcgagcggtacgtcgacaccgccgagctgaacaagcgggtctccgcgcccagcagcgac
cgcgtcacgccgatgatgttcgagcacaagctgctcgaacaggcccgctccgacctgcgc
cgggtcgtcctgccggagggcaccgaggagcgggtgctgcacgcggcggaggtgctgctg
cggcgcggggtgtgcgagctgacccttctcggccccgtcgagcagatccgcaagaaggcc
gccgacctcggcatcgacctcggcggcgccgagctgatcgacccggccgccagcgagctg
cgcgactccttcgccgagaagtacgccgccctgcgcgcccacaagggcgtgaccgtggag
ctggcgtacgacgtggtctcggacgtgaactacttcggcacgctgatggtgcaggagggg
ttcgccgacggcatggtgtcggggtcggtgcactcgacggcggcgaccatccggcccgcc
ttcgagatcatcaagaccaagccggacgcggccatcgtctcctccgtcttcttcatgtgc
ctggccgacaaggtgctggtctacggcgactgcgcggtcaacccggacccggacgcggag
cagctcgccgacatcgcgacgcagtccgcctcgaccgccgcgcagttcggggtggagccg
cggatcgcgatgctgtcgtactcgaccggcacgtccggttccggcgcggacgtcgacaag
gtccgcgaggccaccgagctggtccgctcgcgccgcccggacctcagcgtcgaggggccg
atccagtacgacgcggcggtcgagccgtcggtcgccgcgaccaagctgcccggctccgcg
gtcgccgggcaggccagcgtgctgatcttccccgacctgaacaccggcaacaacacctac
aaggcggtgcagcgctcggccggcgccatcgcggtcggcccggtgctccagggcctgcgc
aagccggtcaacgacctgtcccggggcgcgctcgtgcaggacatcgtcaacaccgtcgcc
atcacggcgatccaggcccagcagtccccgaccgagaaggcgtccgcccagtga

DBGET integrated database retrieval system