KEGG   Streptomyces coelicolor: SCO5425Help
Entry
SCO5425           CDS       T00085                                 

Gene name
pta, SC6A11.01c, SC8F4.29c
Definition
(RefSeq) phosphate acetyltransferase
  KO
K13788  
phosphate acetyltransferase [EC:2.3.1.8]
Organism
sco  Streptomyces coelicolor
Pathway
Taurine and hypotaurine metabolism
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SCO5425 (pta)
   00640 Propanoate metabolism
    SCO5425 (pta)
  Energy metabolism
   00680 Methane metabolism
    SCO5425 (pta)
  Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    SCO5425 (pta)
Enzymes [BR:sco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.8  phosphate acetyltransferase
     SCO5425 (pta)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(5895700..5897793)
Genome map
AA seq 697 aa AA seqDB search
MTRSVYVTGIDRGDGRQVVELGVMELLTRQVDRVGVFRPLVHDGPDRLFELLRARYRLSQ
DPATVYGMDYQEASLLQAEQGVDELVSALVDRFHLVARDYDVVLVLGTDYADTQFPDELS
LNARLANEFGASVLPVVGGRKQTADSVLAETHNAFRAYDGLGCDVLAMVTNRVAREDRDE
IAERLAHRLPVPCWVVPDEPALSAPTVSQIAHALGAEIVLGDDSGLARDALDFVFGGAML
PNLLAALTPGCLVITPGDRADLVIGTLAAHSAGTPPIAGVLLTLNEVPGEGILTLAARLA
PGTPVLSVTGTSFPTAERLFSLEGKLGAATPRKAETALGLFERYVDTAELNKRVSAPSSD
RVTPMMFEHKLLEQARSDLRRVVLPEGTEERVLHAAEVLLRRGVCELTLLGPVEQIRKKA
ADLGIDLGGAELIDPAASELRDSFAEKYAALRAHKGVTVELAYDVVSDVNYFGTLMVQEG
FADGMVSGSVHSTAATIRPAFEIIKTKPDAAIVSSVFFMCLADKVLVYGDCAVNPDPDAE
QLADIATQSASTAAQFGVEPRIAMLSYSTGTSGSGADVDKVREATELVRSRRPDLSVEGP
IQYDAAVEPSVAATKLPGSAVAGQASVLIFPDLNTGNNTYKAVQRSAGAIAVGPVLQGLR
KPVNDLSRGALVQDIVNTVAITAIQAQQSPTEKASAQ
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcgcagcgtgtacgtgaccggcatcgaccgcggcgacggccgccaggtcgtcgag
ctgggggtcatggaactgctgacccggcaggtcgaccgggtcggcgtcttccgtcccctg
gtgcacgacgggccggaccggctcttcgaactgctgcgcgcccgctaccggctctcgcag
gaccccgcgacggtctacggcatggactaccaggaggcctccctcctccaggcggaacag
ggcgtggacgagctggtgtccgcgctggtcgaccgcttccacctggtcgcgcgggactac
gacgtcgtcctggtcctgggcaccgactacgccgacacccagttcccggacgagctgtcc
ctgaacgcgcggctcgccaacgagttcggcgcctcggtcctccccgtcgtcgggggccgc
aagcagaccgccgactcggtgctggccgagacccacaacgccttccgtgcctacgacggc
ctcggctgcgacgtgctcgccatggtgaccaaccgggtcgcgcgcgaggaccgggacgag
atcgccgagcggctcgcgcaccggctgccggtgccgtgctgggtggtaccggacgagccc
gccctgtcggcgccgacggtctcccagatcgcgcacgccctgggcgccgagatcgtcctc
ggcgacgactccgggctcgcccgcgacgcgctggacttcgtcttcggcggggccatgctg
cccaacctgctggccgcgctgaccccgggctgcctggtcatcacgcccggcgaccgcgcc
gacctggtgatcggcacgctggccgcgcacagcgccggcaccccgccgatagccggggtg
ctgctgacgctgaacgaggtgcccggcgagggcatcctcaccctcgccgcccggctggcc
cccggcacgccggtgctctcggtgacgggcaccagctttcccaccgcggaacggctcttc
tccctggagggcaagctgggcgcggccaccccgcgcaaggcggagaccgccctcggcctc
ttcgagcggtacgtcgacaccgccgagctgaacaagcgggtctccgcgcccagcagcgac
cgcgtcacgccgatgatgttcgagcacaagctgctcgaacaggcccgctccgacctgcgc
cgggtcgtcctgccggagggcaccgaggagcgggtgctgcacgcggcggaggtgctgctg
cggcgcggggtgtgcgagctgacccttctcggccccgtcgagcagatccgcaagaaggcc
gccgacctcggcatcgacctcggcggcgccgagctgatcgacccggccgccagcgagctg
cgcgactccttcgccgagaagtacgccgccctgcgcgcccacaagggcgtgaccgtggag
ctggcgtacgacgtggtctcggacgtgaactacttcggcacgctgatggtgcaggagggg
ttcgccgacggcatggtgtcggggtcggtgcactcgacggcggcgaccatccggcccgcc
ttcgagatcatcaagaccaagccggacgcggccatcgtctcctccgtcttcttcatgtgc
ctggccgacaaggtgctggtctacggcgactgcgcggtcaacccggacccggacgcggag
cagctcgccgacatcgcgacgcagtccgcctcgaccgccgcgcagttcggggtggagccg
cggatcgcgatgctgtcgtactcgaccggcacgtccggttccggcgcggacgtcgacaag
gtccgcgaggccaccgagctggtccgctcgcgccgcccggacctcagcgtcgaggggccg
atccagtacgacgcggcggtcgagccgtcggtcgccgcgaccaagctgcccggctccgcg
gtcgccgggcaggccagcgtgctgatcttccccgacctgaacaccggcaacaacacctac
aaggcggtgcagcgctcggccggcgccatcgcggtcggcccggtgctccagggcctgcgc
aagccggtcaacgacctgtcccggggcgcgctcgtgcaggacatcgtcaacaccgtcgcc
atcacggcgatccaggcccagcagtccccgaccgagaaggcgtccgcccagtga

DBGET integrated database retrieval system