KEGG   Streptomyces coelicolor: SCO5470Help
Entry
SCO5470           CDS       T00085                                 

Gene name
glyA
Definition
(RefSeq) serine hydroxymethyltransferase
  KO
K00600  
glycine hydroxymethyltransferase [EC:2.1.2.1]
Organism
sco  Streptomyces coelicolor
Pathway
Glycine, serine and threonine metabolism
Cyanoamino acid metabolism
Glyoxylate and dicarboxylate metabolism
One carbon pool by folate
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sco00001]
   00630 Glyoxylate and dicarboxylate metabolism
    SCO5470 (glyA)
  Energy metabolism
   00680 Methane metabolism
    SCO5470 (glyA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCO5470 (glyA)
  Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    SCO5470 (glyA)
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SCO5470 (glyA)
Enzymes [BR:sco01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.1  glycine hydroxymethyltransferase
     SCO5470 (glyA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(5955947..5957209)
Genome map
AA seq 420 aa AA seqDB search
MSLLNTPLHELDPDVAAAVDAELDRQQSTLEMIASENFAPVAVMEAQGSVLTNKYAEGYP
GRRYYGGCEHVDVVEQIAIDRVKALFGAEHANVQPHSGAQANAAAMFALLKPGDTIMGLN
LAHGGHLTHGMKINFSGKLYNVVPYHVGDDGQVDMAEVERLAKETKPKLIVAGWSAYPRQ
LDFAAFRKVADEVGAYLMVDMAHFAGLVAAGLHPNPVPHAHVVTTTTHKTLGGPRGGVIL
STAELAKKINSAVFPGQQGGPLEHVVAAKAVAFKVAASEDFKERQGRTLEGARILAERLV
RDDAKAAGVSVLTGGTDVHLVLVDLRDSELDGQQAEDRLHEVGITVNRNAVPNDPRPPMV
TSGLRIGTPALATRGFTAEDFAEVADVIAEALKPSYDAEALKARVKTLADKHPLYPGLNK
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcttctgaacacacccctgcacgagctggacccggacgtcgccgccgccgtcgac
gccgagctggaccgccagcagtccaccctcgagatgatcgcgtcggagaacttcgccccg
gtcgcggtcatggaggcccagggctcggtcctcaccaacaagtacgccgagggctacccc
ggccgccgctactacggcggctgcgagcacgtcgacgtggtcgagcagatcgccatcgac
cgggtcaaggcgctcttcggcgccgagcacgccaacgtgcagccgcactcgggcgcccag
gccaacgcggccgcgatgttcgcgctgctcaagcccggcgacacgatcatgggtctgaac
ctcgcgcacggcgggcacctgacccacggcatgaagatcaacttctccggcaagctctac
aacgtggtcccctaccacgtcggcgacgacggccaggtcgacatggccgaggtggagcgc
ctggccaaggagaccaagccgaagctgatcgtggcgggctggtcggcctacccgcgtcag
ctggacttcgccgcgttccgcaaggtcgcggacgaggtcggcgcgtacctgatggtcgac
atggcgcacttcgccggtctggtcgcggcgggcctgcacccgaacccggtcccgcacgcc
cacgtcgtcaccacgaccacccacaagacgctgggcggtccgcgcggcggtgtgatcctc
tccacggccgagctggccaagaagatcaactccgccgtcttccccggtcagcagggtggc
ccgctggagcacgtggtggccgccaaggccgtcgccttcaaggtcgccgcgagcgaggac
ttcaaggagcgccagggccgtacgctggagggtgcccgcatcctggccgagcgcctggtg
cgggacgacgcgaaggccgcgggcgtctccgtcctgaccggcggcacggacgtccacctg
gtcctggtggacctgcgcgactccgagctggacggacagcaggccgaggaccgcctccac
gaggtcggcatcacggtcaaccgcaacgccgtcccgaacgacccgcgcccgccgatggtg
acctccggtctgcgcatcggtacgccggccctggcgacccgcggcttcaccgccgaggac
ttcgccgaggtcgcggacgtgatcgccgaggcgctgaagccgtcctacgacgcggaggcc
ctcaaggcccgggtgaagaccctggccgacaagcacccgctgtacccgggtctgaacaag
tag

DBGET integrated database retrieval system