KEGG   Streptomyces coelicolor: SCO5472Help
Entry
SCO5472           CDS       T00085                                 

Gene name
gcvT
Definition
(RefSeq) glycine cleavage system aminomethyltransferase T
  KO
K00605  
aminomethyltransferase [EC:2.1.2.10]
Organism
sco  Streptomyces coelicolor
Pathway
Glycine, serine and threonine metabolism
Glyoxylate and dicarboxylate metabolism
One carbon pool by folate
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SCO5472 (gcvT)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SCO5472 (gcvT)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCO5472 (gcvT)
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SCO5472 (gcvT)
Enzymes [BR:sco01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     SCO5472 (gcvT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(5957728..5958846)
Genome map
AA seq 372 aa AA seqDB search
MSSTELRRTALDATHRALGATMTDFAGWDMPLRYGSEREEHVAVRTRAGLFDLSHMGEIT
VTGPQAAELLNFALVGNIGTVKPGRARYTMICREDGGILDDLIVYRLEEAEYMVVANASN
AQVVLDALTERAAGFDAEVRDDRDAYALLAVQGPESPGILASLTDADLDGLKYYAGLPGT
VAGVPALIARTGYTGEDGFELFVKPEHAVGLWQALTGAGEAAGLIPCGLSCRDTLRLEAG
MPLYGNELSTALTPFDAGLGRVVKFEKEGDFVGRAALTEAAERAASRPPRVLVGLVAEGR
RVPRSGYRVVAGGEVIGEVTSGAPSPTLGRPIAMAYVDPAHAAPGTEGVGVDIRGSHEPY
EVVALPFYKRQK
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgagcagtaccgaactgcgccgtaccgcgctcgatgccacgcatcgcgcgctgggcgcg
acgatgaccgacttcgccggctgggacatgccgctgcgctacggctccgagcgcgaggag
cacgtcgcggtgcgcacccgcgccggtctcttcgacctgtcgcacatgggtgagatcacc
gtcaccggcccgcaggcggccgagctgctgaacttcgcgctggtcggcaacatcggcacc
gtgaagccgggccgggcgcgctacaccatgatctgccgcgaggacggcggcatcctggac
gacctgatcgtctatcggctcgaagaggccgagtacatggtcgtcgccaacgcctccaac
gcccaggtcgtcctggacgcgctgaccgagcgggcggccgggttcgacgccgaggtgcgc
gacgaccgggacgcctacgcgctgctcgccgtgcagggccccgagtccccgggcatcctc
gcgtcgctcaccgacgccgatctggacggcctgaagtactacgccggtctgcccggaacg
gtcgccggcgtcccggcgctgatcgcgcgcaccggctacaccggcgaggacggcttcgag
ctgttcgtgaagccggagcacgccgtcgggctgtggcaggcactgaccggggcgggcgag
gccgcggggctgatcccgtgcggtctgtcctgccgggacacgctccgcctggaggcgggc
atgccgctgtacggcaacgagctgtcgaccgcgctgacgccgttcgacgccggtctgggc
cgggtggtgaagttcgagaaggagggcgacttcgtcgggcgcgccgcgctgaccgaggcc
gccgagcgcgccgcttcccggccgccccgcgtcctggtcggcctggtcgccgagggccgc
cgggtcccgcgctccgggtaccgggtcgtcgcgggcggcgaggtgatcggcgaggtcacc
tccggcgctccgtccccgacgctgggcaggccgatcgccatggcgtacgtcgaccccgca
cacgcggccccgggcaccgagggcgtgggcgtggacatccggggcagccacgagccgtac
gaggtcgtggcgctgccgttctacaagcgccagaagtag

DBGET integrated database retrieval system