KEGG   Streptomyces coelicolor: SCO5514Help
Entry
SCO5514           CDS       T00085                                 

Gene name
ilvC, SC8D9.26
Definition
(RefSeq) ketol-acid reductoisomerase
  KO
K00053  
ketol-acid reductoisomerase [EC:1.1.1.86]
Organism
sco  Streptomyces coelicolor
Pathway
Valine, leucine and isoleucine biosynthesis
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    SCO5514 (ilvC)
   01230 Biosynthesis of amino acids
    SCO5514 (ilvC)
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    SCO5514 (ilvC)
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SCO5514 (ilvC)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.86  ketol-acid reductoisomerase (NADP+)
     SCO5514 (ilvC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
6005643..6006641
Genome map
AA seq 332 aa AA seqDB search
MAELFYDADADLSIIQGRKVAVIGYGSQGHAHALSLRDSGVDVRVGLHEGSKSKAKAEEQ
GLRVVPVAEAAAEADVIMILVPDPIQAEVYEKDIKDNLKDGDALFFGHGLNIRYGFIKPP
AGVDVCMVAPKGPGHLVRRQYEEGRGVPCIAAVEQDATGNAFALALSYAKGIGGTRAGVI
KTTFTEETETDLFGEQAVLCGGTAALVKAGFETLTEAGYQPEIAYFECLHELKLIVDLMY
EGGLEKMRWSISETAEWGDYVTGPRIITDATKAEMKKVLAEIQDGTFAKNWMDEYHGGLK
KYNEYKKQDSEHLLETTGKELRKLMSWVDEEA
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
gtggccgagctgttctacgacgccgacgccgacctgtccatcatccagggccgcaaggtc
gcggtcatcgggtacggcagccagggccacgcccacgccctgtcgctgcgcgactccggt
gtcgacgtgcgcgtcggtctgcacgagggctccaagtccaaggccaaggccgaggagcag
ggcctgcgcgtcgtgccggtggccgaggccgccgccgaggccgacgtcatcatgatcctg
gtcccggacccgatccaggccgaggtctacgagaaggacatcaaggacaacctgaaggac
ggcgacgcgctgttcttcggtcacggtctgaacatccgctacggcttcatcaagcccccg
gccggcgtggacgtctgcatggtcgcccccaagggcccgggccacctggtgcgccgtcag
tacgaggagggccgcggcgttccctgcatcgccgccgtcgagcaggacgccacgggcaac
gccttcgcgctggccctgtcgtacgccaagggcatcggcggcacccgcgccggcgtcatc
aagacgaccttcaccgaggagaccgagaccgacctcttcggtgagcaggccgtcctgtgc
ggtggcacggccgcgctggtcaaggcgggcttcgagacgctgaccgaggccggttaccag
ccggagatcgcctacttcgagtgcctgcacgagctgaagctgatcgtggacctcatgtac
gagggcggcctggagaagatgcgctggtcgatctccgagaccgccgagtggggcgactac
gtcaccggcccgcggatcatcaccgacgccaccaaggccgagatgaagaaggtcctcgcc
gagatccaggacggcacgttcgccaagaactggatggacgagtaccacggcggtctgaag
aagtacaacgagtacaagaagcaggactccgagcacctcctggagaccaccggcaaggag
ctgcgcaagctcatgagctgggtcgacgaagaggcgtag

DBGET integrated database retrieval system