KEGG   Streptomyces coelicolor: SCO5514Help
Entry
SCO5514           CDS       T00085                                 

Gene name
ilvC, SC8D9.26
Definition
(RefSeq) ketol-acid reductoisomerase
  KO
K00053  
ketol-acid reductoisomerase [EC:1.1.1.86]
Organism
sco  Streptomyces coelicolor
Pathway
Valine, leucine and isoleucine biosynthesis
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    SCO5514 (ilvC)
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SCO5514 (ilvC)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.86  ketol-acid reductoisomerase (NADP+)
     SCO5514 (ilvC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
6005643..6006641
Genome map
AA seq 332 aa AA seqDB search
MAELFYDADADLSIIQGRKVAVIGYGSQGHAHALSLRDSGVDVRVGLHEGSKSKAKAEEQ
GLRVVPVAEAAAEADVIMILVPDPIQAEVYEKDIKDNLKDGDALFFGHGLNIRYGFIKPP
AGVDVCMVAPKGPGHLVRRQYEEGRGVPCIAAVEQDATGNAFALALSYAKGIGGTRAGVI
KTTFTEETETDLFGEQAVLCGGTAALVKAGFETLTEAGYQPEIAYFECLHELKLIVDLMY
EGGLEKMRWSISETAEWGDYVTGPRIITDATKAEMKKVLAEIQDGTFAKNWMDEYHGGLK
KYNEYKKQDSEHLLETTGKELRKLMSWVDEEA
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
gtggccgagctgttctacgacgccgacgccgacctgtccatcatccagggccgcaaggtc
gcggtcatcgggtacggcagccagggccacgcccacgccctgtcgctgcgcgactccggt
gtcgacgtgcgcgtcggtctgcacgagggctccaagtccaaggccaaggccgaggagcag
ggcctgcgcgtcgtgccggtggccgaggccgccgccgaggccgacgtcatcatgatcctg
gtcccggacccgatccaggccgaggtctacgagaaggacatcaaggacaacctgaaggac
ggcgacgcgctgttcttcggtcacggtctgaacatccgctacggcttcatcaagcccccg
gccggcgtggacgtctgcatggtcgcccccaagggcccgggccacctggtgcgccgtcag
tacgaggagggccgcggcgttccctgcatcgccgccgtcgagcaggacgccacgggcaac
gccttcgcgctggccctgtcgtacgccaagggcatcggcggcacccgcgccggcgtcatc
aagacgaccttcaccgaggagaccgagaccgacctcttcggtgagcaggccgtcctgtgc
ggtggcacggccgcgctggtcaaggcgggcttcgagacgctgaccgaggccggttaccag
ccggagatcgcctacttcgagtgcctgcacgagctgaagctgatcgtggacctcatgtac
gagggcggcctggagaagatgcgctggtcgatctccgagaccgccgagtggggcgactac
gtcaccggcccgcggatcatcaccgacgccaccaaggccgagatgaagaaggtcctcgcc
gagatccaggacggcacgttcgccaagaactggatggacgagtaccacggcggtctgaag
aagtacaacgagtacaagaagcaggactccgagcacctcctggagaccaccggcaaggag
ctgcgcaagctcatgagctgggtcgacgaagaggcgtag

DBGET integrated database retrieval system