KEGG   Streptomyces coelicolor: SCO5515Help
Entry
SCO5515           CDS       T00085                                 

Gene name
SC8D9.27, serA
Definition
(RefSeq) D-3-phosphoglycerate dehydrogenase
  KO
K00058  
D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Organism
sco  Streptomyces coelicolor
Pathway
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:sco00001]
  Energy metabolism
   00680 Methane metabolism
    SCO5515 (SC8D9.27)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SCO5515 (SC8D9.27)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     SCO5515 (SC8D9.27)
    1.1.1.399  2-oxoglutarate reductase
     SCO5515 (SC8D9.27)
Exosome [BR:sco04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SCO5515 (SC8D9.27)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
6006860..6008449
Genome map
AA seq 529 aa AA seqDB search
MSSKPVVLIAEELSPATVDALGPDFEIRHCNGADRAELLPAIADVDAILVRSATKVDAEA
VAAAKKLKVVARAGVGLDNVDVSAATKAGVMVVNAPTSNIVTAAELACGLIVATARNIPQ
ANAALKNGEWKRSKYTGVELAEKTLGVVGLGRIGALVAQRMSAFGMKVVAYDPYVQPARA
AQMGVKVLSLDELLEVSDFITVHLPKTPETLGLIGDEALRKVKPSVRIVNAARGGIVDEE
ALYSALKEGRVAGAGLDVYAKEPCTDSPLFEFDQVVATPHLGASTDEAQEKAGIAVAKSV
RLALAGELVPDAVNVQGGVIAEDVKPGLPLAERLGRIFTALAGEVAVRLDVEVYGEITQH
DVKVLELSALKGVFEDVVDETVSYVNAPLFAQERGVEVRLTTSSESPEHRNVVIVRGTLS
DGEEVSVSGTLAGPKHLQKIVAIGEYDVDLALADHMVVLRYEDRPGVVGTVGRIIGEAGL
NIAGMQVARATVGGEALAVLTVDDTVPSGVLAEVAAEIGATSARSVNLV
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
gtgagctcgaaacccgtcgtactcatcgctgaagagctgtcgcccgcgaccgtggacgca
ctcggccccgacttcgagatccgccactgcaacggcgcggaccgggccgaactgctcccc
gccatcgccgacgtggacgcgatcctggtccgctccgcgaccaaggtcgacgccgaggcc
gtggccgccgccaagaagctcaaggtcgtcgcgcgcgccggggtcggcctggacaacgtc
gacgtctccgccgccaccaaggccggcgtgatggtggtcaacgccccgacctccaacatc
gtcaccgccgccgagctggcctgcggcctgatcgtcgccaccgcccgcaacatcccgcag
gccaacgccgcgctgaagaacggcgagtggaagcgcagcaagtacaccggcgtggagctg
gccgagaagaccctcggcgtcgtcggcctcggccgcatcggcgcgctcgtcgcgcagcgc
atgtcggccttcggcatgaaggtcgtcgcctacgacccctacgtgcagcccgcgcgggcc
gcgcagatgggcgtcaaggtgctgtccctggacgagctgctggaggtctccgacttcatc
acggtccacctgcccaagacccccgagaccctcggcctgatcggcgacgaggcgctgcgc
aaggtcaagccgagcgtccgcatcgtcaacgccgcgcgcggcggcatcgtcgacgaggag
gcgctgtactcggcgctcaaggagggccgcgtcgccggcgccggcctcgacgtgtacgcc
aaggagccctgcaccgactcgccgctgttcgagttcgaccaggtggtcgccaccccgcac
ctcggcgcctccaccgacgaggcccaggagaaggccggcatcgccgtcgccaagtcggtc
cgcctggccctcgccggtgagctggtccccgacgcggtcaacgtccagggcggtgtcatc
gccgaggacgtcaagcccggtctgccgctcgccgagcgcctcggccgcatcttcaccgcg
ctcgcgggtgaggtcgccgtccgcctcgacgtcgaggtctacggcgagatcacccagcac
gacgtgaaggtgctggagctgtccgccctcaagggcgtcttcgaggacgtcgtcgacgag
acggtgtcgtacgtcaacgccccgctgttcgcccaggagcgcggcgtcgaggtccggctg
accaccagctcggagtccccggagcaccgcaacgtcgtcatcgtgcgcggcaccctctcg
gacggcgaggaggtgtcggtctccggcacgctggccggcccgaagcacctccagaagatc
gtcgccatcggcgagtacgacgtggacctcgccctcgccgaccacatggtcgtcctgcgc
tacgaggaccgtcccggcgtcgtcggcaccgtcggccggatcatcggcgaggcgggtctc
aacatcgccggcatgcaggtcgcccgcgcgacggtcggcggcgaggcgctggccgtcctc
accgtcgacgacacggtgccctccggggttctggcggaggtcgcggcggagatcggcgcc
acgtccgcccggtccgtcaacctcgtctga

DBGET integrated database retrieval system