KEGG   Streptomyces coelicolor: SCO5520Help
Entry
SCO5520           CDS       T00085                                 

Gene name
SC1C2.01, SC8D9.32
Definition
(RefSeq) 1-pyrroline-5-carboxylate dehydrogenase
  KO
K00294  
1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
sco  Streptomyces coelicolor
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SCO5520 (SC1C2.01)
   00330 Arginine and proline metabolism
    SCO5520 (SC1C2.01)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     SCO5520 (SC1C2.01)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
6013103..6014743
Genome map
AA seq 546 aa AA seqDB search
MDAVTQVPTPVNEPVHGYAPGSPERARLEAKLKELADNPIDLPCTIGGEKRMGGGERFDV
VQPHNHKSRLGTYANATQADAQDAIDAALAAAPAWRAMSFDDRAAIILRAAELLSGPWRE
TIAASTMLGQSKTAQQAEIDSPCELIDFWRFNVHYARNILAEQPPANSQGVWNRMDHRPL
EGFVYAITPFNFSAIAANLPTAPALMGNVVVWKPSPTQTHAAVLLMQLLEEAGLPKGVIN
LVTGDGIAVSEVALEHRDLAGIHFTGSTKTFQHLWKTVGNNIEKYRTYPRLVGETGGKDF
LVAHPSADRAVLKTALTRGAFEYQGQKCSATSRAYIPASIWNDGFKEEFAAEVDYLTMGD
VTDLSNFIGAVIDERSFAKNKAAIDRAKEDETCTIVAGGSYDDSVGYFVRPTVVECTDPE
NEVFRTEYFGPFLAVHVYDDSADDAYDAMLTQMESVSDYALTGSVISNDRAAAAYTMEKL
RYAAGNFYINDKSTGAVVGQQPFGGGRASGTNDKAGAPQNLMRWTLTRAIKETLVAPTDY
TYPHMG
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atggacgctgtgacccaggtccccacccccgtcaacgagccggtgcacggctacgcgccc
ggttcgcccgagcgcgcccgtctggaggccaagctcaaggagctggccgacaacccgatc
gacctgccttgcaccatcggtggcgagaagcggatgggcggcggcgagcgcttcgacgtc
gtgcagccgcacaaccacaagtcccgcctgggcacgtacgccaacgccacgcaagcggac
gcccaggacgcgatcgacgccgccctggccgccgcccccgcgtggcgcgcgatgtccttc
gacgaccgcgcggcgatcatcctgcgcgccgccgagctgctgtccggcccgtggcgcgag
accatcgccgcctccaccatgctcggccagtccaagaccgcccagcaggccgagatcgac
agcccctgcgagctgatcgacttctggcgcttcaacgtgcactacgcgcggaacatcctc
gccgagcagcccccggccaactcccagggcgtgtggaaccgtatggaccaccgcccgctg
gagggcttcgtctacgcgatcacgccgttcaacttcagcgcgatcgcggccaacctgccc
accgccccggccctgatgggcaacgtcgtggtgtggaagccgtccccgacgcagacccac
gccgccgtgctgctcatgcagctgctggaggaggccggactgcccaagggcgtcatcaac
ctggtcaccggcgacggcatcgcggtctccgaggtcgccctggagcaccgggacctcgcg
ggcatccacttcaccggttcgaccaagaccttccagcacctgtggaagacggtcggcaac
aacatcgagaagtaccgcacctacccgcgcctggtcggcgagaccggcggcaaggacttc
ctggtcgcccacccgagcgccgaccgcgccgtcctcaagacggccctgacccgcggtgcc
ttcgagtaccagggccagaagtgcagcgccacctcccgcgcgtacatcccggcgtcgatc
tggaacgacgggttcaaggaggagttcgccgccgaggtcgactacctcaccatgggtgac
gtcaccgacctgtcgaacttcatcggcgcggtcatcgacgagcggtccttcgccaagaac
aaggccgccatcgaccgggccaaggaggacgagacctgcacgatcgtcgcgggcggctcc
tacgacgactcggtcggctacttcgtccgcccgaccgtcgtcgagtgcaccgacccggag
aacgaggtcttccgcaccgagtacttcggccccttcctcgccgtgcacgtgtacgacgac
agcgccgacgacgcgtacgacgcgatgctgacccagatggagtcggtctcggactacgcg
ctcaccggctcggtgatctccaacgaccgcgcggcggccgcgtacacgatggagaagctg
cgctacgcggcgggcaacttctacatcaacgacaagtcgaccggtgccgtggtcggccag
cagcccttcggcggcggccgcgcctccggcaccaacgacaaggccggcgccccgcagaac
ctgatgcgctggacgctgacccgcgccatcaaggagacgctggtcgcaccgaccgactac
acgtacccgcacatgggctga

DBGET integrated database retrieval system