KEGG   Streptomyces coelicolor: SCO5522Help
Entry
SCO5522           CDS       T00085                                 

Gene name
leuB
Definition
(RefSeq) 3-isopropylmalate dehydrogenase
  KO
K00052  
3-isopropylmalate dehydrogenase [EC:1.1.1.85]
Organism
sco  Streptomyces coelicolor
Pathway
Valine, leucine and isoleucine biosynthesis
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    SCO5522 (leuB)
   01230 Biosynthesis of amino acids
    SCO5522 (leuB)
  Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    SCO5522 (leuB)
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    SCO5522 (leuB)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.85  3-isopropylmalate dehydrogenase
     SCO5522 (leuB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
6015259..6016302
Genome map
AA seq 347 aa AA seqDB search
MSRSLNLAVIPGDGIGQEVVAEGLKVLSAVLPQDVKLETKEFDFGARRYHATGETLTDAD
LDALKAHDAILLGAIGDPSVPSGVLERGFLLKLRFAFDHHVNLRPSKLLPGVATPLAGQP
EIDFVVVREGTEGPYTGNGGTIRKGTEHEVATEVSVNTAYGVERVVRDAFARAQARPRKK
LTLVHKNNVLTFAGHLWTNIFNKVAAEYPEVTTDYLHVDAATIFLVTDPARFDVIVTDNL
FGDIITDLAAAVSGGIGVAASGNINPSGDFPSMFEPVHGSAPDIAGQGKADPTATVLSVA
LLLRHLGYEDEAARIEDAVSADLGERGDLPARSTSEIGDTLAARVAG
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgcagcctcaatctcgcagtgatccccggtgacggcatcggccaggaggtcgtg
gccgagggtctcaaggtcctctccgccgtccttccgcaggatgtgaagctggagaccaag
gagttcgacttcggcgcccggcgctaccacgccaccggtgagaccctcaccgacgccgac
ctcgacgccctcaaggcgcacgacgccatcctgctcggcgccatcggcgacccctcggtg
ccgtccggcgtgctggagcgcggcttcctgctcaagctccgcttcgccttcgaccaccac
gtcaacctgcggccgagcaagctcctgcccggcgtcgccaccccgctcgccggccagccc
gagatcgacttcgtcgtcgtccgcgagggcaccgagggcccgtacaccggcaacggcggc
accatccgcaagggcaccgagcacgaggtcgccaccgaggtctccgtcaacacggcctac
ggcgtcgagcgcgtcgtccgcgacgccttcgcccgcgcccaggcccgcccgcgcaagaag
ctcacgctggtccacaagaacaacgtgctgaccttcgcgggccacctgtggaccaacatc
ttcaacaaggtcgcggcggagtaccccgaggtcaccaccgactacctccacgtcgacgcc
gcgaccatcttcctggtcaccgacccggcccggttcgacgtgatcgtcaccgacaacctc
ttcggcgacatcatcaccgacctcgccgcggccgtctccggcggcatcggcgtcgccgcc
agtgggaacatcaacccgtccggcgacttcccctcgatgttcgagccggtgcacggctcc
gcgccggacatcgccggccagggcaaggccgaccccaccgccacggtcctgtccgtcgcc
ctgctgctgcgccacctcgggtacgaggacgaggccgcccggatcgaggacgccgtctcc
gccgacctcggcgagcgcggcgacctgcccgcccgcagcacctccgagatcggcgacact
ctcgccgcacgagtagcgggctga

DBGET integrated database retrieval system