KEGG   Streptomyces coelicolor: SCO5523Help
Entry
SCO5523           CDS       T00085                                 

Gene name
ilvE
Definition
(RefSeq) branched-chain amino acid aminotransferase
  KO
K00826  
branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
sco  Streptomyces coelicolor
Pathway
Cysteine and methionine metabolism
Valine, leucine and isoleucine degradation
Valine, leucine and isoleucine biosynthesis
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
Pantothenate biosynthesis, valine/L-aspartate => pantothenate
Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    SCO5523 (ilvE)
   01230 Biosynthesis of amino acids
    SCO5523 (ilvE)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SCO5523 (ilvE)
   00280 Valine, leucine and isoleucine degradation
    SCO5523 (ilvE)
   00290 Valine, leucine and isoleucine biosynthesis
    SCO5523 (ilvE)
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SCO5523 (ilvE)
Enzymes [BR:sco01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     SCO5523 (ilvE)
Amino acid related enzymes [BR:sco01007]
 Aminotransferase (transaminase)
  Class IV
   SCO5523 (ilvE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
6016567..6017655
Genome map
AA seq 362 aa AA seqDB search
MTTPTIELKPSAHPLSDSERAAILANPGFGRHFTDHMVTIKWTEGRGWHDGQLVPYAPLS
LDPATMVLHYAQEIFEGLKAYRRPDGSVATFRPEKNGARFQASSRRLGMPELPVDTFIEA
CDALVAQDEKWVPAHGGEESLYLRPFMIATEVGLGVRPANEYLFIVIASPAGAYFPGGVK
PVSIWVSEDRVRAVPGGMGDAKTGGNYAASLLAQAEAAAKGCDQVCYLDAIERKWVEELG
GMNLYFVYGNKIVTPSLTGSILEGVTRDSLLTVARDLGYEAEEGRVSVDQWQRDSENGTL
TEVFACGTAAVITPVGTVKRAGAQWQQSGGETGEVTQRLRDALLDIQRGTVADPHGWMHT
LA
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgcccacgatcgagctcaagccctctgcccacccgctctcggactccgagcgc
gcggcgattctggccaaccccgggttcggccgccacttcaccgaccacatggtgacgatc
aagtggaccgagggccgcggctggcacgacggccagctggtgccgtacgccccgctctcc
ctcgacccggccaccatggtcctgcactacgcgcaggagatcttcgagggcctgaaggcc
taccggcggcccgacggctccgtcgccaccttccgcccggagaagaacggcgcccgcttc
caggcgtcctcgcgccgcctgggcatgcccgagcttcccgtggacaccttcatcgaggcc
tgcgacgcgctggtcgcgcaggacgagaagtgggtgccggcgcacggcggcgaggagtcc
ctgtacctgcgccccttcatgatcgcgaccgaggtcggcctgggcgtcaggccggccaac
gagtacctcttcatcgtcatcgcctccccggccggcgcctacttcccgggcggggtcaag
ccggtctccatctgggtctccgaggaccgcgtccgcgccgtccccggcggcatgggcgac
gccaagaccggcggcaactacgcggcctccctgctcgcccaggccgaggccgccgccaag
ggctgcgaccaggtctgctacctcgacgccatcgagcgcaagtgggtcgaggaactgggc
ggcatgaacctgtacttcgtgtacggcaacaagatcgtcacgccctccctcaccggctcc
atcctggagggcgtcacccgcgactccctgctcaccgtcgcccgcgacctcggttacgag
gccgaggagggccgcgtctcggtcgaccagtggcagcgcgactcggagaacggcaccctc
accgaggtcttcgcctgcggcaccgcggccgtgatcacccccgtcggcacggtcaagcgg
gccggcgcgcagtggcagcagagcgggggcgagacgggtgaggtgacgcagcggctgcgg
gacgcgctgctcgacattcagcgcgggacggtcgccgacccgcacgggtggatgcacacg
ctggcctga

DBGET integrated database retrieval system