KEGG   Streptomyces coelicolor: SCO5529Help
Entry
SCO5529           CDS       T00085                                 

Gene name
SC1C2.10
Definition
(RefSeq) alpha-isopropylmalate/homocitrate synthase family transferase
  KO
K01649  
2-isopropylmalate synthase [EC:2.3.3.13]
Organism
sco  Streptomyces coelicolor
Pathway
Valine, leucine and isoleucine biosynthesis
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    SCO5529 (SC1C2.10)
   01230 Biosynthesis of amino acids
    SCO5529 (SC1C2.10)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SCO5529 (SC1C2.10)
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    SCO5529 (SC1C2.10)
Enzymes [BR:sco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.13  2-isopropylmalate synthase
     SCO5529 (SC1C2.10)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
6023669..6025273
Genome map
AA seq 534 aa AA seqDB search
MTATSELDDSFHVFDTTLRDGAQREGINLTVADKLAIARHLDDFGVGFIEGGWPGANPRD
TEFFARARQEIDFKHAQLVAFGSTRRAGANAAEDHQVKALLDSGAQVITLVAKSHDRHVE
LALRTTLDENLAMVADTVSHLKAQGRRVFVDCEHFFDGYRANPEYAKSVVRTASEAGADV
VVLCDTNGGMLPAQIQAVVATVLADTGARLGIHAQDDTGCAVANTLAAVDAGATHVQCTA
NGYGERVGNANLFPVVAALELKYGKQVLPEGRLREMTRISHAIAEVVNLTPSTHQPYVGV
SAFAHKAGLHASAIKVDPDLYQHIDPELVGNTMRMLVSDMAGRASIELKGKELGIDLGGD
RELVGRVVERVKERELAGYTYEAADASFELLLRAEAEGRPLKYFEVESWRAITEDRPDGS
HANEATVKLWAKGERIVATAEGNGPVNALDRSLRVALEKIYPELAKLDLVDYKVRILEGV
HGTQSTTRVLISTSDGTGEWATVGVAENVIAASWQALEDAYTYGLLRAGVAPAE
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcaaccagcgaactcgacgattcgttccacgtcttcgacaccaccctgcgcgac
ggcgcgcagcgcgagggcatcaacctcacggtcgcggacaagctggccatcgcacggcac
ctggacgacttcggggtgggcttcatcgagggcggctggcccggcgccaacccgcgggac
accgagttcttcgcccgcgcccggcaggagatcgacttcaagcacgcccagctggtcgcc
ttcggctccacccgccgcgcgggcgcgaacgccgccgaggaccaccaggtcaaggcgctg
ctcgactccggcgcccaggtgatcaccctggtcgccaagtcgcacgaccggcacgtcgaa
ctggccctgcgcaccacgctggacgagaacctcgcgatggtggccgacacggtctcccac
ctgaaggcgcagggccgccgggtcttcgtcgactgcgagcacttcttcgacggctaccgc
gccaaccccgagtacgcgaagtcggtcgtgcgcaccgcctccgaggccggcgccgacgtc
gtcgtcctgtgcgacaccaacggcggcatgctcccggcgcagatccaggcggtggtcgcc
acggtgctggccgacaccggcgcccggctcggcatccacgcccaggacgacaccggctgc
gccgtcgccaacaccctcgccgccgtcgacgcgggcgcgacccacgtccagtgcacggcc
aacggctacggcgagcgggtcggcaacgccaacctgttccccgtcgtggccgcgctggag
ctgaagtacggcaagcaggtgctgcccgagggccggctgcgcgagatgacccgcatctcc
cacgccatcgccgaggtcgtcaacctcacgccctccacccaccagccctacgtgggcgtc
tccgccttcgcccacaaggccggcctgcacgcctccgcgatcaaggtcgacccggacctc
taccagcacatcgaccccgaactggtcggcaacaccatgcggatgctggtctccgacatg
gcgggacgtgcctccatcgagctgaagggcaaggagctcgggatcgacctcggcggcgac
cgcgagctggtcggccgggtcgtggagcgggtcaaggagcgcgagctggccggctacacc
tacgaggccgccgacgcgagcttcgagctgctgctgcgcgccgaggccgagggcaggccg
ctgaagtacttcgaggtcgagtcctggcgcgcgatcaccgaggaccgccccgacggcagc
cacgccaacgaggccacggtcaagctctgggccaagggcgagcgcatcgtcgccaccgcc
gagggcaacggcccggtcaacgccctggaccggtcgctgcgcgtggccctggagaagatc
taccccgagctggccaagctcgacctggtcgactacaaggtccgcatcctggagggcgtg
cacggcacccagtccaccaccagggtcctcatctccacgtccgacggcacgggggagtgg
gccacggtgggtgtcgcggagaacgtcatcgccgcctcctggcaggcgctggaggacgcg
tacacgtacgggctgctgcgggcgggggtcgcgcccgccgagtga

DBGET integrated database retrieval system