KEGG   Streptomyces coelicolor: SCO5535Help
Entry
SCO5535           CDS       T00085                                 

Gene name
SC1C2.16
Definition
(RefSeq) carboxyl transferase
Organism
sco  Streptomyces coelicolor
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
6031665..6033248
Genome map
AA seq 527 aa AA seqDB search
MTVLDEAPGEPTDARGRVAELHGIRAAALAGPSEKATAAQHAKGKLTARERIELLLDPGS
FREVEQLRRHRATGFGLEAKKPYTDGVITGWGTVEGRTVFVYAHDFRIFGGALGEAHATK
IHKIMDMAIAAGAPLVSLNDGAGARIQEGVSALAGYGGIFQRNTKASGVIPQISVMLGPC
AGGAAYSPALTDFVFMVRDTSQMFITGPDVVKAVTGEEITQNGLGGADVHAETSGVCHFA
YDDEETCLAEVRYLLSLLPQNNRENPPRAESSDPVDRRSDTLLDLVPADGNRPYDMTKVI
EELVDEGEYLEVHERWARNIICALARLDGRVVGIVANQPQALAGVLDIEASEKAARFVQM
CDAFNIPIITLLDVPGFLPGVDQEHGGIIRHGAKLLYAYCNATVPRISLILRKAYGGAYI
VMDSQSIGADLTYAWPTNEIAVMGAEGAANVIFRRQIADAEDPEAMRARMVKEYKSELMH
PYYAAERGLVDDVIDPAETREVLITSLAMLHTKHADLPSRKHGNPPQ
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgaccgttttggatgaggcgccgggcgagccgacggacgcgcgcgggcgggtggccgag
ctgcacgggatccgtgcagcggcgctcgccgggccgagtgagaaggcgacggcggcgcag
cacgccaagggcaagctgacggcacgtgagcgcatcgagctgctcctggaccccggctcc
ttccgcgaggtcgagcagctgcgccggcaccgggcgaccgggttcggcctggaggccaag
aagccgtacaccgacggtgtcatcaccggctggggcacggtcgagggccgcacggtcttc
gtctacgcccacgacttccggatcttcggcggcgcgctgggcgaggcccacgccacgaag
atccacaagatcatggacatggccatcgcggccggtgccccgctggtgtcgctgaacgac
ggcgccggcgcccgtatccaggagggcgtcagcgcgctcgccgggtacggcggcatcttc
cagcgcaacaccaaggcgtccggcgtcatcccgcagatcagcgtgatgctcggcccctgc
gcgggcggcgcggcctacagccccgccctcaccgacttcgtcttcatggtccgcgacacc
tcgcagatgttcatcacgggcccggacgtcgtcaaggcggtcaccggcgaggagatcacg
cagaacggtctgggcggcgccgacgtgcacgccgagacgtccggcgtgtgccacttcgcc
tacgacgacgaggagacctgcctcgccgaggtccgctacctcctctccctcctcccgcag
aacaaccgggagaacccgccccgcgccgagtcctccgaccccgtggaccgccgctcggac
accctcctcgacctggtcccggcggacggcaaccgcccgtacgacatgaccaaggtcatc
gaggaactcgtcgacgagggcgagtacctggaggtccacgagcgttgggcccgcaacatc
atctgcgcgctggcccgtctcgacgggcgggtcgtgggcatcgtcgccaaccagccgcag
gccctggccggtgtcctggacatcgaggcgtcggagaaggcggcccgcttcgtccagatg
tgcgacgccttcaacatcccgatcatcactcttctggacgtacccggcttcctgcccggc
gtcgaccaggagcacggcgggatcatccgccacggcgccaagctgctctacgcgtactgc
aacgcgaccgtgccccggatctcgctgatcctgcgcaaggcgtacggaggtgcttacatc
gtcatggacagccagtccatcggcgccgacctcacctacgcctggccgaccaacgagatc
gccgtcatgggcgcggaaggtgccgcgaacgtcatcttccgccggcagatcgccgacgcc
gaggaccccgaggccatgcgggcgcgcatggtcaaggagtacaagtccgagctgatgcac
ccctactacgcggccgaacgcggtctggtcgacgacgtcatcgaccccgccgaaacccgc
gaggtgctgatcacgtccctggcgatgctccacaccaagcacgccgacctgccctcccgc
aagcacggcaacccgccgcagtga

DBGET integrated database retrieval system