KEGG   Streptomyces coelicolor: SCO5560Help
Entry
SCO5560           CDS       T00085                                 

Gene name
ddl
Definition
(RefSeq) D-alanyl-alanine synthetase A
  KO
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sco  Streptomyces coelicolor
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    SCO5560 (ddl)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SCO5560 (ddl)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    SCO5560 (ddl)
Enzymes [BR:sco01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SCO5560 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
6058385..6059554
Genome map
AA seq 389 aa AA seqDB search
MSTENLPQNPEQSPRRPPRKPRVAVVFGGRSSEHGISVVTAGAVLAAIDRTRYDVLPIGI
TRDGRWALTADEPERMAITERRTPDVEELAESTEGGVLLPVDPANREVVYSEPGSVPKAL
GEVDVVFPVLHGPYGEDGTLQGLLELSGVPYVGAGVLASAVGQDKEYMKAVFTSYGLKVG
PYAVIRPREWEQDRSGARKKIVDFAGEHGWPLFVKPARAGSSIGITKVDDLAGLDEAIEE
ARRHDPKILVEAALRGREIECGVLEFEDGPRASVPAEIPPPSEHAYYDFEAKYIDSTPGI
VPAPLTAEETAEVQRLAVAAFDAASCEGLVRADFFLTEDDEFVINEINTMPGFTPISMYP
QMWQASGVSYPELVDRLVQAALRRPTGLR
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgagaacctcccccagaaccctgagcagagccctcggcggcctccccgcaag
ccgcgtgtggccgtcgtgttcggcggtcgcagctccgaacacgggatctccgtggtcacc
gccggcgccgtcctcgcggccatcgaccggacgcgctacgacgtcctgccgatcggcatc
accagggacggccgctgggccctcaccgccgacgaaccggaacgcatggcgatcaccgaa
cgccgtacgcccgacgtcgaggaactggccgagtcgaccgagggcggagtgctgctcccc
gtcgaccccgccaaccgcgaagtcgtctacagcgaaccgggctcggtgcccaaggcgctc
ggcgaggtcgacgtcgtcttccccgtgctgcacggcccctacggcgaggacggcaccctc
cagggcctgctggagctgtccggtgtgccctacgtcggcgcgggcgtgctcgcctccgcc
gtcggccaggacaaggagtacatgaaggcggtcttcacctcctacgggctgaaggtcggc
ccgtacgcggtgatccggccccgcgagtgggagcaggaccgttccggggcccgcaagaag
atcgtcgacttcgccggggagcacggctggccgctgttcgtgaagcccgcgcgcgcgggt
tcctcgatcggcatcaccaaggtcgacgacctcgccggcctcgacgaggcgatcgaggag
gcccgccgccacgacccgaagatcctggtcgaggccgcgctgcggggccgggagatcgag
tgcggggtgctggagttcgaggacggcccccgggcctccgtcccggccgagatcccgccg
ccctcggagcacgcgtactacgacttcgaggccaagtacatcgactccacccccggcatc
gtgccggctcccctcacggccgaggagaccgccgaggtccagcgcctggccgtcgcggcg
ttcgacgcggcctcctgcgaggggctggtgcgcgcggacttcttcctcaccgaggacgac
gagttcgtgatcaacgagatcaacaccatgcccggcttcacgccgatctccatgtacccg
cagatgtggcaggcgagcggagtgagctacccggagctggtggaccggctggtccaggcg
gcgctgcggcggcccaccggactgcgctga

DBGET integrated database retrieval system