KEGG   Streptomyces coelicolor: SCO5568Help
Entry
SCO5568           CDS       T00085                                 

Gene name
coaD
Definition
(RefSeq) phosphopantetheine adenylyltransferase
  KO
K00954  
pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
sco  Streptomyces coelicolor
Pathway
Pantothenate and CoA biosynthesis
Metabolic pathways
Module
Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    SCO5568 (coaD)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     SCO5568 (coaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
6067241..6067720
Genome map
AA seq 159 aa AA seqDB search
MRRAVCPGSFDPITNGHLDIIARASSLYDEVYVAVMINQAKKGLFEIEERIDLIRRVTAE
YGNVRVESFHGLLVDFCKQREIPAIVKGLRAVSDFDYELQMAQMNNGLSGVETLFIPTNP
TYSFLSSSLVKEVATWGGDVAHLVPPLVLEALTERLRNR
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
gtgcgccgtgccgtctgtcccgggtcgttcgacccgatcaccaacggacacctcgacatc
atcgcccgggcctccagcctgtacgacgaggtctacgtcgccgtgatgatcaaccaggcg
aagaagggcctgttcgagatcgaggagcggatcgacctcatccgccgggtcaccgccgag
tacgggaacgtccgcgtggagtccttccacggtctgctcgtcgacttctgcaagcagcgc
gagatcccggccatcgtcaagggcctgcgggcggtcagcgacttcgactacgagttgcag
atggcccagatgaacaacggcctctccggtgtggagaccctcttcatccccaccaacccc
acctacagcttcctgtcgtcctccctggtcaaggaggtcgcgacctggggcggcgacgtc
gcccacctggtgccgccgctggtcctcgaagccctcacggagcgcctgaggaaccgctga

DBGET integrated database retrieval system