KEGG   Streptomyces coelicolor: SCO5576Help
Entry
SCO5576           CDS       T00085                                 

Gene name
SC7A1.20
Definition
(RefSeq) acylphosphatase
  KO
K01512  
acylphosphatase [EC:3.6.1.7]
Organism
sco  Streptomyces coelicolor
Pathway
Pyruvate metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SCO5576 (SC7A1.20)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SCO5576 (SC7A1.20)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.7  acylphosphatase
     SCO5576 (SC7A1.20)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
6073650..6073931
Genome map
AA seq 93 aa AA seqDB search
MSEDVRLVAWVRGQVQGVGFRWFTRARALELGGMSGFALNLGDGRVQVVAEGPRERCEGL
LEWLRGDDTPGRVDGVTEIWDTPRGGYEGFAIR
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaggatgtacggctggtcgcgtgggtgcgcggacaggtccagggcgtgggattc
cggtggttcacgcgggccagggcactggaactcggcgggatgagtggttttgctctcaat
ctgggcgacggccgggtgcaggtcgtcgcggagggcccgcgcgagcgctgcgagggactg
ctcgagtggctgcgcggtgacgacacgcccggacgcgtggacggagtcaccgagatctgg
gacacaccccgcggggggtacgagggcttcgccatccgctga

DBGET integrated database retrieval system