KEGG   Streptomyces coelicolor: SCO5628Help
Entry
SCO5628           CDS       T00085                                 

Gene name
SC6A9.39c
Definition
(RefSeq) hypothetical protein
  KO
K00981  
phosphatidate cytidylyltransferase [EC:2.7.7.41]
Organism
sco  Streptomyces coelicolor
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SCO5628 (SC6A9.39c)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.41  phosphatidate cytidylyltransferase
     SCO5628 (SC6A9.39c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
6127060..6128235
Genome map
AA seq 391 aa AA seqDB search
MNDSSWGAPPQAGYWGPSDQGPVQGAGPAGPAYDAHYAQQTRPMPIVPDVPEHGGDQDDD
QGTARLSGPLFRDEPFHDQPPRDEPYRDQNPSAQPYAAVPQNPEPMPDAPQPAQSQPPPQ
KKSAGRDLGAAIGVGVGLGVVIIASLFVVKAVFVGVIAVAVVVGLWELTKRLEERKGIKA
PLVPLAIGGAAMVVAGYARGAEGAWVAMALTALAVLVWRMTEPPEGYLKDVTAGLFAAFY
VPFLATFVAMMLAADDGAWRVLVFLILTVVSDTGAYAVGWRFGRKKLAPRISPGKTREGL
LGAIAFAMVAGALCMQFLIDDGAWWQGLLLGLVVAVSATLGDLGESMIKRDLGIKDMGTL
LPGHGGIMDRLDSLLPTAPVVWLLLVIFVGS
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaacgactcttcctggggagcgccgccacaagccgggtactgggggccgtccgaccag
ggacccgtccagggcgccggtccggcgggtcccgcgtacgatgcgcactacgcgcagcag
actcgccccatgcccatcgtgcccgacgtacccgaacacggcggagaccaggacgacgac
caggggaccgctcggctgagcggtcccttgttccgggacgagccgtttcacgaccagccc
cctcgcgacgagccgtaccgcgatcagaacccgtcggcgcagccgtatgcggcggtgccg
cagaatccggagcccatgcccgacgccccgcagccggcgcagtcccagccgccgccgcag
aagaagagcgcggggcgtgacctgggcgccgcgataggggtgggcgtcggactcggcgtg
gtgatcatcgcgtcgctgttcgtcgtcaaggccgtcttcgtcggtgtgatcgcggtcgcc
gtcgtggtgggcctgtgggagctgaccaagcggctggaggagcgcaagggcatcaaggcg
cccctcgtaccgctcgcgatcggcggcgcggcgatggtggtcgccggctacgcgcgcggc
gccgagggggcgtgggtcgccatggccctcaccgcgctcgcggtcctggtctggcggatg
acggagccgccggaggggtacctcaaggacgtcacggcagggctcttcgccgcgttctac
gtgccgttcctggccaccttcgtcgccatgatgctggcggcggacgacggcgcctggcgc
gtcctggtcttcctgatactgacggtcgtcagcgacaccggggcctacgccgtcggctgg
cgcttcggcaggaagaagctcgccccgcgcatcagccccggcaagacccgcgagggcctg
ctgggagccatcgcgttcgcgatggtggcgggtgcgctgtgcatgcagttcctgatcgac
gacggtgcctggtggcagggcctgctgctcggcctcgtggtcgccgtcagcgccaccctg
ggcgacctcggcgagtccatgatcaagcgagacctcggcatcaaggacatgggcaccctc
ctgccgggccacggcggcatcatggaccgcctcgactccctcctcccgacggcaccggtg
gtgtggctgctgctggtgatcttcgtggggtcgtga

DBGET integrated database retrieval system