KEGG   Streptomyces coelicolor: SCO5676Help
Entry
SCO5676           CDS       T00085                                 

Gene name
gabT
Definition
(RefSeq) 4-aminobutyrate aminotransferase
  KO
K07250  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
sco  Streptomyces coelicolor
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SCO5676 (gabT)
   00650 Butanoate metabolism
    SCO5676 (gabT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SCO5676 (gabT)
   00280 Valine, leucine and isoleucine degradation
    SCO5676 (gabT)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SCO5676 (gabT)
Enzymes [BR:sco01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SCO5676 (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     SCO5676 (gabT)
Amino acid related enzymes [BR:sco01007]
 Aminotransferase (transaminase)
  Class III
   SCO5676 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(6176557..6177891)
Genome map
AA seq 444 aa AA seqDB search
MTALPQERRVVTAIPGPKSQELQARRTAVVAQGVGSTLPVFVARAGGGVIEDVDGNRLID
FGSGIAVTSVGASAEAVVRKASAQLADFTHTCFMVTPYEGYVAVAEALAELTPGDHAKKS
ALFNSGAEAVENAVKIARAYTKRQAVVVFDHGYHGRTNLTMALTAKNMPYKHGFGPFAPE
VYRVPVAYGYRWPTGAENAGPEAAAQAIDQISKQVGAENVAAVIIEPVLGEGGFIEPAKG
FLPAIREFASDNGIVFVADEIQSGFCRTGQWFACEDEGIVPDLITTAKGIAGGLPLSAVT
GRAEIMDAAHSGGLGGTYGGNPVACAGALGAIETMKELDLNARAKDIEAVMKSRLAAMAE
KFDVIGDVRGRGAMIAIELVKDRETKEPNPAATAALAKACHQEGLLVLTCGTYGNVLRFL
PPLVIGEDLLNEGLDIIEQAFTRV
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacttccgcaggagcgccgcgtcgtcaccgccattcccggcccgaagtcgcag
gagctgcaggcccgccgtacggccgtggtcgcgcagggtgtgggctccacgctgcccgtc
ttcgtcgcgcgcgccggcggcggtgtcatcgaggacgtcgacggcaaccgcctgatcgac
ttcggctccggcatcgcggtgacctccgtcggcgcctccgccgaggccgtcgtgcgcaag
gcgtccgcgcagctcgccgacttcacccacacctgtttcatggtcacgccgtacgagggc
tacgtcgccgtcgccgaggcgctggccgagctgacgccgggcgaccacgccaagaagtcg
gcgctgttcaacagcggcgccgaggccgtcgagaacgccgtcaagatcgcccgtgcgtac
accaagcggcaggccgtggtcgtcttcgaccacgggtaccacggccggaccaacctgacc
atggcgctgaccgcgaagaacatgccgtacaagcacggcttcggtccgttcgcgcccgag
gtgtaccgggtaccggtcgcctacggctaccgctggcccacgggtgcggagaacgccggt
ccggaggccgccgcgcaggcgatcgaccagatcagcaagcaggtcggtgccgagaacgtg
gccgcggtcatcatcgagccggtgctcggcgagggcggcttcatcgagccggccaagggc
ttcctgcccgcgatccgggagttcgcctcggacaacggcatcgtcttcgtcgccgacgag
atccagtccggcttctgccgcaccggccagtggttcgcctgcgaggacgagggcatcgtc
ccggacctgatcacgacggcgaagggcatcgcgggcggtctgccgctgtccgccgtcacc
ggccgcgccgagatcatggacgccgcgcactccggcggcctcggcggcacctacggcggc
aacccggtggcgtgcgcgggcgcgctcggtgccatcgagacgatgaaggagctggacctc
aacgcccgggcgaaggacatcgaggcggtcatgaagtcccgcctggccgccatggccgag
aagttcgacgtcatcggcgacgtccggggccgcggcgcgatgatcgcgatcgagctggtc
aaggaccgcgagaccaaggagccgaacccggcggcgacggccgcgctcgccaaggcctgc
caccaggaggggctgctggtcctgacctgtggcacctacggcaacgtgctgcgcttcctg
cccccgctggtgatcggggaggacctgctgaacgagggtctcgacatcatcgagcaggcg
ttcacccgcgtctga

DBGET integrated database retrieval system