KEGG   Streptomyces coelicolor: SCO5679Help
Entry
SCO5679           CDS       T00085                                 

Gene name
SC5H4.03
Definition
(RefSeq) aldehyde dehydrogenase
  KO
K00128  
aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sco  Streptomyces coelicolor
Pathway
Glycolysis / Gluconeogenesis
Ascorbate and aldarate metabolism
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Arginine and proline metabolism
Histidine metabolism
Tryptophan metabolism
beta-Alanine metabolism
Glycerolipid metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SCO5679 (SC5H4.03)
   00053 Ascorbate and aldarate metabolism
    SCO5679 (SC5H4.03)
   00620 Pyruvate metabolism
    SCO5679 (SC5H4.03)
  Lipid metabolism
   00071 Fatty acid degradation
    SCO5679 (SC5H4.03)
   00561 Glycerolipid metabolism
    SCO5679 (SC5H4.03)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SCO5679 (SC5H4.03)
   00310 Lysine degradation
    SCO5679 (SC5H4.03)
   00330 Arginine and proline metabolism
    SCO5679 (SC5H4.03)
   00340 Histidine metabolism
    SCO5679 (SC5H4.03)
   00380 Tryptophan metabolism
    SCO5679 (SC5H4.03)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SCO5679 (SC5H4.03)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SCO5679 (SC5H4.03)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SCO5679 (SC5H4.03)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SCO5679 (SC5H4.03)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
6182246..6183691
Genome map
AA seq 481 aa AA seqDB search
MTSTHAFWLAGRQAAGESGFDVTSPWDGTTVGTVSLPTDAQVEEAVAAAYAVRDEFAATP
AHVRAAALDHVGRRLAERTEEIARLISAENGKPVKWARGEVGRAVSVFRFAAEEARRFNG
GEAQRLDTDAGGQGRLALTRRFPKGVVLGIAPFNFPLNLCAHKIAPAIAAGAPLILKPAP
ATPLSGLILGELLAETDLPAGSWSILPVPNDKMPALVQDERLPVISFTGSETVGYAIMDS
VPRKHCTLELGGNGAAVVLADWASDEDLDRAATRIATFSNYQGGQSCISVQRVIADAAVY
DRLLPRIVAAVEAQVTGDPNDDATDVGPLVSEAAAERVEAWVREAVDAGAKLLTGGKRDG
ASYAPTVLTELPADTTLAHEEVFGPVLSVQRVTGEAEAFAAVNDSKYGLQAGVFTHDLQA
AFRAHRALEVGGVVIGDIPSYRADQMPYGGAKQSGVGREGVKFAMDDYTYERVLVLTGLA
L
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgacttccacccacgccttctggctcgccggccgccaggccgccggcgagtccggcttc
gacgtcacgtccccctgggacggcaccaccgtcggcacggtgagcctgcccaccgacgcc
caggtcgaggaggcggtggccgccgcgtacgccgtacgggacgagttcgccgccaccccc
gcccacgtacgggccgccgccctcgaccacgtcggccgccgcctggccgagcgcaccgag
gagatcgcccgcctgatctccgccgagaacggcaagcccgtcaagtgggcccgcggcgag
gtcggccgcgccgtctccgtgttccgcttcgccgccgaggaggcccgccgtttcaacggc
ggcgaggcccagcgcctggacaccgacgccggcggccaggggcgcctggccctcacccgc
cgcttccccaagggcgtggtcctcggcatcgcgcccttcaacttccccctcaacctgtgc
gcccacaagatcgcccccgcgatcgccgccggcgcgcccctcatcctcaagccggccccc
gccacccccctgtccggcctgatcctcggcgaactcctcgccgagaccgacctgcccgcc
ggctcctggagcatcctcccggtcccgaacgacaagatgcccgccctcgtccaggacgag
cgcctcccggtcatctccttcaccggctccgagaccgtcggctacgcgatcatggactcg
gtgccccgcaagcactgcacgctggagctgggcggcaacggcgcggccgtcgtcctcgcc
gactgggcgagcgacgaggacctggaccgggccgcgacgcgcatcgccaccttctccaac
taccagggcggccagtcctgcatctccgtgcagcgcgtgatcgccgacgccgccgtctac
gaccgcctgctgccccgcatcgtcgccgccgtcgaggcccaggtcaccggcgacccgaac
gacgacgcgacggacgtcggcccgctggtcagcgaggccgccgccgagcgcgtggaggcc
tgggtgcgggaggccgtcgacgcgggcgcgaagctcctcaccggcggcaagcgcgacggc
gcctcctacgccccgaccgtcctcaccgagctgcccgccgacaccaccctcgcccacgag
gaggtcttcggccccgtcctcagcgtgcagcgggtgaccggtgaggccgaggccttcgcc
gccgtcaacgactccaagtacggccttcaggcaggcgtgttcacccacgacctccaggcc
gccttccgcgcccaccgcgccctggaggtcggcggcgtcgtcatcggcgacatcccctcc
taccgcgccgaccagatgccgtacggcggggccaagcagtccggagtcggccgcgagggc
gtgaagttcgcgatggacgactacacctacgagcgggtgctggtcctcaccggactcgcg
ctctga

DBGET integrated database retrieval system