KEGG   Streptomyces coelicolor: SCO5711Help
Entry
SCO5711           CDS       T00085                                 

Gene name
ribC, ribF
Definition
(RefSeq) bifunctional riboflavin kinase/FMN adenylyltransferase
  KO
K11753  
riboflavin kinase / FMN adenylyltransferase [EC:2.7.1.26 2.7.7.2]
Organism
sco  Streptomyces coelicolor
Pathway
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    SCO5711 (ribC)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.26  riboflavin kinase
     SCO5711 (ribC)
   2.7.7  Nucleotidyltransferases
    2.7.7.2  FAD synthetase
     SCO5711 (ribC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
6225981..6226937
Genome map
AA seq 318 aa AA seqDB search
MQRWRGLEDIPEDWGRSVVTIGSYDGVHRGHQLIIRHAVDRARELGVPAVVVTFDPHPSE
VVRPGSHPPLLAPHHRRAELMADLGVDAVLILPFTKEFSKLSAADFVVKVLVDRLRAKAV
VEGPNFRFGHKAAGNVDFLIEQGKVYDFEVEVVDLYVTGDAGGGEPFSSTLTRRLVAEGD
VAGAAEILGRPHRVEGVVVRGAQRGREMGFPTANVETLPHTAIPADGVYAGWLHAQGEAM
PAAISVGTNPQFEGTERTVEAYAIDRVGLELYGLHVAVDFVAFVRGQAKFETLDALLEQM
AVDVDRCREITATDAPRP
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
gtgcagcgctggcgtggcttggaggacatccccgaggactggggacgcagcgtcgtcacc
atcggctcctacgacggtgtccaccgcggacaccagctgatcatcaggcacgccgtggac
cgcgcccgcgagctgggcgtccccgccgtcgtcgtcaccttcgacccgcaccccagcgag
gtcgtccgccccggcagccacccgccgctgctcgccccgcaccaccgcagggccgaactg
atggcggacctgggggtggacgccgtgctgatcctccccttcaccaaggagttctcgaag
ctctccgccgccgacttcgtggtcaaggtcctggtcgaccggctgcgcgccaaggccgtc
gtcgagggccccaacttccgcttcggccacaaggccgccgggaacgtggacttcctcatc
gagcaggggaaggtctacgacttcgaggtcgaggtcgtcgacctgtacgtcaccggcgac
gcgggcggcggcgagccgttctcctccaccctgacccgccgcctggtggccgagggcgac
gtggcgggcgccgcggagatcctgggccgcccgcaccgcgtcgagggcgtcgtcgtgcgg
ggcgcccagcgcggccgcgagatgggcttccccacggccaacgtcgagacgctcccgcac
accgcgatcccggccgacggcgtctacgccggctggctgcacgcccagggcgaggcgatg
ccggccgcgatctccgtcggcaccaacccgcagttcgagggcaccgagcgcacggtcgag
gcgtacgccatcgaccgcgtgggcctcgagctgtacggcctgcacgtcgccgtggacttc
gtggccttcgtacgcggacaggcgaagttcgagacgctggacgcgctcctcgagcagatg
gccgtggacgtggacaggtgccgcgagatcaccgcgacggacgcccccaggccctga

DBGET integrated database retrieval system