KEGG   Streptomyces coelicolor: SCO5739Help
Entry
SCO5739           CDS       T00085                                 

Gene name
dapB
Definition
(RefSeq) 4-hydroxy-tetrahydrodipicolinate reductase (EC:1.3.1.26)
  KO
K00215  
4-hydroxy-tetrahydrodipicolinate reductase [EC:1.17.1.8]
Organism
sco  Streptomyces coelicolor
Pathway
Monobactam biosynthesis
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SCO5739 (dapB)
  Amino acid metabolism
   00300 Lysine biosynthesis
    SCO5739 (dapB)
  Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    SCO5739 (dapB)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.8  4-hydroxy-tetrahydrodipicolinate reductase
     SCO5739 (dapB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
6263394..6264146
Genome map
AA seq 250 aa AA seqDB search
MSKLRVAVLGAKGRIGSEAVRAVEAAEDMELVAALGRGDGLEALAESGAQVAVELTTPAS
VMDNLDYCLRHGIHAVVGTTGWTDERLARLNAWLDASPGTGVLIAPNFSIGAVLTMKFAQ
IAAPYFESVEVVELHHPNKVDAPSGTATRTAQLIAQARQKAGSAPAPDATATALDGARGA
NVDGVPVHAVRLRGLLAHQEVLLGAEGETLTVRHDSLHHSSFMPGILLGARRVVTTPGLT
FGLEHFLDLN
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagctgcgcgtggccgtcctcggcgccaagggccggatcggctccgaggcggta
cgggcggtcgaggccgccgaggacatggagctggtcgcggccctgggccggggcgacggc
ctggaggccctggccgagtccggcgcccaggtcgccgtcgagctgaccacccccgcctcg
gtgatggacaacctcgactactgcctgcgccacggcatccacgccgtcgtcggcaccacc
ggctggaccgacgagcgcctcgcacggctgaacgcgtggctcgacgcctccccggggacc
ggcgtgctcatcgcgccgaacttctccatcggcgccgtgctgaccatgaagttcgcgcag
atcgcggccccgtacttcgagtccgtcgaggtcgtcgagctgcaccacccgaacaaggtg
gacgcccccagcggcaccgccacccgcaccgcccagctgatcgctcaggcccggcagaag
gcaggctccgcaccggcgcccgacgccactgccaccgccctggacggcgcccgcggcgcg
aacgtcgacggggtcccggtgcacgcggtccggctgcgcggcctgctcgcccaccaggag
gtcctgctcggcgccgagggcgagaccctcaccgtccggcacgactccctgcaccacagc
agcttcatgccgggcatcctgctgggcgcccgccgggtggtcaccaccccgggcctcacc
ttcggcctggaacacttcctggacctgaactga

DBGET integrated database retrieval system