KEGG   Streptomyces coelicolor: SCO5743Help
Entry
SCO5743           CDS       T00085                                 

Gene name
thyX
Definition
(RefSeq) FAD-dependent thymidylate synthase
  KO
K03465  
thymidylate synthase (FAD) [EC:2.1.1.148]
Organism
sco  Streptomyces coelicolor
Pathway
Pyrimidine metabolism
One carbon pool by folate
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SCO5743 (thyX)
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SCO5743 (thyX)
Enzymes [BR:sco01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.148  thymidylate synthase (FAD)
     SCO5743 (thyX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
6265793..6266533
Genome map
AA seq 246 aa AA seqDB search
MTDIPADDPKIELRSDITVELVKSAATDSDVLFAARVSTAGEQSLDELKKDPERSKGLIN
YLMRDRHGSPFEHNSMTFFVSAPIFVFREFMRHRVGWSYNEESGRYRELQPVFYAPDASR
KLVQQGRPGKYVFVEGTPEQHELVGSAMEDSYRQAYATYQQMLAAGVAREVARAVLPVGL
YSSMYATCNARSLMHFLGLRTQHELAKVPSFPQREIEMAGEKMEAEWARLMPLTHAAFNA
NGRVAP
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacatccccgccgacgatccgaagatcgaactccgcagcgacatcaccgtcgag
ctggtcaagagcgccgcgaccgactccgacgtgctgttcgccgcccgtgtctccaccgcc
ggggagcagtccctggacgagctgaagaaggacccggagcgctccaagggcctgatcaac
tacctcatgcgggaccggcacggcagcccgttcgagcacaactcgatgaccttcttcgtg
agcgccccgatcttcgtcttccgggagttcatgcggcaccgcgtcggctggtcctacaac
gaggagtcgggccgctaccgggagctccagccggtcttctacgccccggacgcctcccgc
aagctggtgcagcagggccgccccggcaagtacgtcttcgtcgagggcacccccgagcag
cacgagctggtcgggagcgcgatggaggactcctaccgccaggcctacgcgacgtaccag
cagatgctcgccgccggcgtcgcccgcgaggtggcccgtgcggtgctccccgtcggcctg
tactcgtcgatgtacgcgacctgcaacgcccgctcgctgatgcacttcctgggtctgcgc
acccagcacgaactggccaaggtgccctccttcccgcagcgggagatcgagatggccggc
gagaagatggaggcggagtgggcccgcctcatgccgctcacccacgccgccttcaacgcc
aacggccgcgtggcgccgtaa

DBGET integrated database retrieval system