KEGG   Streptomyces coelicolor: SCO5744Help
Entry
SCO5744           CDS       T00085                                 

Gene name
dapA
Definition
(RefSeq) 4-hydroxy-tetrahydrodipicolinate synthase
  KO
K01714  
4-hydroxy-tetrahydrodipicolinate synthase [EC:4.3.3.7]
Organism
sco  Streptomyces coelicolor
Pathway
Monobactam biosynthesis
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SCO5744 (dapA)
  Amino acid metabolism
   00300 Lysine biosynthesis
    SCO5744 (dapA)
  Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    SCO5744 (dapA)
Enzymes [BR:sco01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.3  Amine-lyases
    4.3.3.7  4-hydroxy-tetrahydrodipicolinate synthase
     SCO5744 (dapA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
6266753..6267652
Genome map
AA seq 299 aa AA seqDB search
MAPTSTPQTPFGRVLTAMVTPFTADGALDLDGAQRLAAHLVDAGNDGLIINGTTGESPTT
SDAEKADLVRAVVEAVGDRAHVVAGVGTNNTQHSIELARAAERVGAHGLLLVTPYYNKPP
QEGLYLHFTAIADAAGLPVMLYDIPGRSGVPINTETLVRLAEHPRIVANKDAKGDLGRAS
WAIARSGLAWYSGDDMLNLPLLAVGAVGFVSVVGHVVTPELRAMVDAHVAGDVQKALEIH
QKLLPVFTGMFRTQGVMTTKGALALQGLPAGPLRAPMVGLTPEETEQLKIDLAAGGVQL
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggctccgacctccactccgcagacccccttcgggcgggtcctcaccgccatggtcacg
cccttcacggcggacggcgcactcgacctcgacggcgcccagcggctcgccgcccacctg
gtggacgcaggcaacgacggcctgatcatcaacggcaccaccggcgagtccccgaccacc
agcgacgcggagaaagcggacctcgtacgggccgtcgtggaggcggtcggcgaccgggcg
cacgtggtggccggagtcggcaccaacaacacccagcacagcatcgagctggcccgcgcc
gccgagcgcgtcggcgcccacggcctgctgctcgtcacgccgtactacaacaagcccccg
caggagggcctgtacctgcacttcacggccatcgccgacgccgccgggctgccggtcatg
ctctacgacatccccggccgcagcggcgtcccgatcaacaccgagaccctggtccgcctc
gcggagcacccgcggatcgtcgccaacaaggacgccaagggcgacctcggccgggccagc
tgggccatcgcgcgctccggcctcgcctggtactccggcgacgacatgctcaacctgccg
ctgctcgccgtgggcgcggtcggcttcgtctccgtcgtgggccacgtcgtcaccccggag
ctgcgcgccatggtggacgcgcacgtcgccggtgacgtacagaaggccctggagatccac
cagaagctgctccccgtcttcaccggcatgttccgcacccagggcgtcatgaccaccaag
ggcgcgctcgccctccagggactgcccgcgggaccgctgcgcgcccccatggtcggcctc
acgcccgaggaaaccgagcagctcaagatcgatcttgccgccggcggggtacagctctga

DBGET integrated database retrieval system