KEGG   Streptomyces coelicolor: SCO5753Help
Entry
SCO5753           CDS       T00085                                 

Gene name
pgsA
Definition
(RefSeq) phosphatidylglycerophosphate synthase
  KO
K00995  
CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase [EC:2.7.8.5]
Organism
sco  Streptomyces coelicolor
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SCO5753 (pgsA)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.5  CDP-diacylglycerol---glycerol-3-phosphate 1-phosphatidyltransferase
     SCO5753 (pgsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
6291623..6292414
Genome map
AA seq 263 aa AA seqDB search
MTGVPASAAGGSSSARRTGPRGASGAAQEPAGRTTSGGAVERDAGERRGATEGGAGARGG
KIAAAAVNQASVWNVANLLTMLRLLLVPAFVALMLGNGGYDPAWRSFAWAAFAIAMITDL
FDGHLARTYNLVTDFGKIADPIADKAIMGAALICLSALGDLPWWVTAVILGRELGITVLR
FVVIRYGVIPASRGGKLKTLIQGIAVGMYVLALTGPLATLRFWVMAAAVVLTVATGLDYV
KQAIVLRRRGIAERRAALKETEV
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaccggagtcccggcgtccgcggcgggcggctcctccagtgcgcgccggaccggcccg
cgcggcgcctcgggcgcggcacaggaaccggccgggcgcacgacttcggggggcgccgtg
gaacgggatgcgggagagcggcgaggggccaccgagggtggtgccggcgcgcgcggtggc
aagatcgcggcggccgccgtcaaccaggcgagtgtctggaacgtcgccaatctgctgacg
atgctccggctgctcctggtgccggccttcgtcgcgctcatgctcggcaacggcgggtac
gacccggcctggcgctccttcgcctgggccgccttcgccatcgccatgatcaccgacctc
ttcgacggtcacctggcgcgcacttacaacctcgtcaccgacttcgggaagatcgccgat
cccatcgccgacaaggcgatcatgggtgcggcgctcatctgcctgtccgcgctcggcgac
ctgccgtggtgggtgacggccgtcatcctcggccgggaactcgggatcaccgtcctgcgt
ttcgtggtcatccggtacggcgtcatccccgcgagccggggcggcaagctcaagacgctc
atccagggcatcgccgtcggcatgtacgtcctggcgctgacggggcccctggccaccctg
aggttctgggtgatggcggcggcggtcgtcctgaccgtcgcgaccggcctggactatgtg
aagcaggccattgtgctgcgccgccggggaatcgccgaacgcagagcggcgttgaaggag
acggaagtttga

DBGET integrated database retrieval system