KEGG   Streptomyces coelicolor: SCO5777Help
Entry
SCO5777           CDS       T00085                                 

Gene name
gluA
Definition
(RefSeq) glutamate uptake system ATP-binding protein
  KO
K10008  
glutamate transport system ATP-binding protein [EC:3.6.3.-]
Organism
sco  Streptomyces coelicolor
Pathway
ABC transporters
Module
Glutamate transport system
Brite
KEGG Orthology (KO) [BR:sco00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SCO5777 (gluA)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     SCO5777 (gluA)
Transporters [BR:sco02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Glutamate transporter [MD:M00233] [OT]
    SCO5777 (gluA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
complement(6314572..6315348)
Genome map
AA seq 258 aa AA seqDB search
MTEVSVAKEDKAATGELVVLKSVNKHFGALHVLQDIDLTIQRGEVVVVIGPSGSGKSTLC
RTINRLETVDDGSITIDGKPLPAEGKELARLRADVGMVFQSFNLFAHKTVLENVTLGQVK
VRKVDAKKAEEKARALLDRVGVGAQADKYPAQLSGGQQQRVAIARALAMDPKVMLFDEPT
SALDPEMINEVLEVMKQLAEDGMTMIVVTHEMGFARSAANRVVFMADGRIVEEATPDQFF
SNPRSDRAKDFLSKILHH
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagtatcggtggccaaggaagacaaggctgcgaccggcgaactggtcgtcctg
aagagtgtcaacaagcacttcggcgcgttgcacgtgctccaggacattgacctgacgatt
cagcgcggcgaggtcgtcgtggtcatcggaccctccgggtccggcaagtccaccctgtgc
cgcaccatcaaccggctggagaccgtcgacgacggttcgatcacgatcgacggcaagccg
ctgcccgccgagggcaaggagctggccaggctgcgggccgacgtcggcatggtcttccag
tcgttcaacctcttcgcgcacaagacggtgctcgagaacgtgaccctgggccaggtcaag
gtccgcaaggtcgacgccaagaaggccgaggagaaggcccgcgccctgctcgaccgggtc
ggcgtgggcgcgcaggcggacaagtaccccgcgcagctgtccggcggccagcagcagcgt
gtcgccatcgcgcgtgcgctggccatggacccgaaggtcatgctcttcgacgagccgacg
tcggccctcgacccggagatgatcaacgaggtcctcgaggtcatgaagcagctcgccgag
gacgggatgaccatgatcgtggtcacgcacgagatgggcttcgcccgctcggccgccaac
cgcgtggtgttcatggcggacggccgcatcgtcgaagaggccacgccggaccagttcttc
agcaatccgcgcagcgaccgtgccaaggacttcctgtcgaagatcctgcaccactga

DBGET integrated database retrieval system