KEGG   Streptomyces coelicolor: SCO5793Help
Entry
SCO5793           CDS       T00085                                 

Gene name
dapF
Definition
(RefSeq) diaminopimelate epimerase
  KO
K01778  diaminopimelate epimerase [EC:5.1.1.7]
Organism
sco  Streptomyces coelicolor
Pathway
sco00300  Lysine biosynthesis
sco01100  Metabolic pathways
sco01110  Biosynthesis of secondary metabolites
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
sco01230  Biosynthesis of amino acids
Module
sco_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    SCO5793 (dapF)
Enzymes [BR:sco01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.7  diaminopimelate epimerase
     SCO5793 (dapF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAP_epimerase
Motif
Other DBs
NCBI-GeneID: 1101235
NCBI-ProteinID: NP_629917
Kitasato: SCO5793
UniProt: O69969
Position
6329272..6330141
Genome map
AA seq 289 aa AA seqDB search
MSTRIAFLKGHGTENDFVIVPDPENALDLPPAAVAALCDRRAGLGGDGLLHVVRSAAHPE
ARGMAAEAEWFMDYRNGDGSVAEMCGNGVRVFARYLQHAGHVTEGDLAVATRGGVKTVHI
AKNGDVTVGMGRALLPAGDVEVSVGEREWPARNVNMGNPHAVAFVADLDHAGDLYAPPSH
APAGAYPDGVNVEFVVDRGPRHVAMRVHERGSGETRSCGTGACAVAVATARRDGLDPAAT
GTPATYTVDVPGGTLVITERPDGEIEMTGPAVIVAEGEFDSAWLEGVLA
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgcggatcgctttcctcaagggtcacggcaccgagaacgacttcgtgatcgtt
cccgacccggagaacgccctcgacctgccccccgccgccgtcgccgccctgtgcgaccgc
cgagcgggcctcggcggggacggcctgctgcacgtggtgcggtccgcggcgcaccccgag
gcccggggcatggccgccgaggcggagtggttcatggactaccgcaacggcgacggctcg
gtcgcggagatgtgcggcaacggcgtgcgggtcttcgcgcgctacctccagcacgccggg
cacgtcaccgagggagacctcgccgtcgccacgcgcgggggcgtgaagaccgtgcacatc
gccaagaacggcgacgtcaccgtcggcatgggccgggcgctgctgcccgcgggcgacgtc
gaggtgagcgtgggcgagcgcgagtggcccgcgcggaacgtgaacatgggcaacccgcac
gcggtcgccttcgtcgccgacctcgaccacgcgggcgacctgtacgccccgccctcgcac
gcgcccgccggcgcctatccggacggggtcaacgtcgagttcgtggtcgaccggggcccc
cgccacgtcgcgatgcgcgtgcacgagcgcggctccggcgagacccgctcctgcggtacg
ggcgcgtgcgccgtcgccgtcgccaccgcccgccgggacggcctcgaccccgcggccacc
gggaccccggccacctacaccgtcgacgtgcccggcggcaccctggtgatcaccgagcgc
ccggacggcgagatcgagatgacggggccggccgtgatcgtcgcggagggcgagttcgac
tccgcctggctggaaggggtactcgcctga

DBGET integrated database retrieval system