KEGG   Streptomyces coelicolor: SCO5793Help
Entry
SCO5793           CDS       T00085                                 

Gene name
dapF
Definition
(RefSeq) diaminopimelate epimerase
  KO
K01778  
diaminopimelate epimerase [EC:5.1.1.7]
Organism
sco  Streptomyces coelicolor
Pathway
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SCO5793 (dapF)
  Amino acid metabolism
   00300 Lysine biosynthesis
    SCO5793 (dapF)
Enzymes [BR:sco01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.7  diaminopimelate epimerase
     SCO5793 (dapF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
6329272..6330141
Genome map
AA seq 289 aa AA seqDB search
MSTRIAFLKGHGTENDFVIVPDPENALDLPPAAVAALCDRRAGLGGDGLLHVVRSAAHPE
ARGMAAEAEWFMDYRNGDGSVAEMCGNGVRVFARYLQHAGHVTEGDLAVATRGGVKTVHI
AKNGDVTVGMGRALLPAGDVEVSVGEREWPARNVNMGNPHAVAFVADLDHAGDLYAPPSH
APAGAYPDGVNVEFVVDRGPRHVAMRVHERGSGETRSCGTGACAVAVATARRDGLDPAAT
GTPATYTVDVPGGTLVITERPDGEIEMTGPAVIVAEGEFDSAWLEGVLA
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgcggatcgctttcctcaagggtcacggcaccgagaacgacttcgtgatcgtt
cccgacccggagaacgccctcgacctgccccccgccgccgtcgccgccctgtgcgaccgc
cgagcgggcctcggcggggacggcctgctgcacgtggtgcggtccgcggcgcaccccgag
gcccggggcatggccgccgaggcggagtggttcatggactaccgcaacggcgacggctcg
gtcgcggagatgtgcggcaacggcgtgcgggtcttcgcgcgctacctccagcacgccggg
cacgtcaccgagggagacctcgccgtcgccacgcgcgggggcgtgaagaccgtgcacatc
gccaagaacggcgacgtcaccgtcggcatgggccgggcgctgctgcccgcgggcgacgtc
gaggtgagcgtgggcgagcgcgagtggcccgcgcggaacgtgaacatgggcaacccgcac
gcggtcgccttcgtcgccgacctcgaccacgcgggcgacctgtacgccccgccctcgcac
gcgcccgccggcgcctatccggacggggtcaacgtcgagttcgtggtcgaccggggcccc
cgccacgtcgcgatgcgcgtgcacgagcgcggctccggcgagacccgctcctgcggtacg
ggcgcgtgcgccgtcgccgtcgccaccgcccgccgggacggcctcgaccccgcggccacc
gggaccccggccacctacaccgtcgacgtgcccggcggcaccctggtgatcaccgagcgc
ccggacggcgagatcgagatgacggggccggccgtgatcgtcgcggagggcgagttcgac
tccgcctggctggaaggggtactcgcctga

DBGET integrated database retrieval system