KEGG   Streptomyces coelicolor: SCO5794Help
Entry
SCO5794           CDS       T00085                                 

Gene name
SC4H2.15
Definition
(RefSeq) kinase/phosphohydrolase
  KO
K00951  
GTP pyrophosphokinase [EC:2.7.6.5]
Organism
sco  Streptomyces coelicolor
Pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SCO5794 (SC4H2.15)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.5  GTP diphosphokinase
     SCO5794 (SC4H2.15)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
6330388..6332565
Genome map
AA seq 725 aa AA seqDB search
MNAEAVNPASPGPVPPTATGAVTPAPRRKARPRIDLRRLGRAALLGSATRSRGLPDAIGH
VVEAHRAHHPDADLDPLRRAYVLAESSHRGQMRKSGEPYITHPLAVTLILAELGAETTTL
TASLLHDTVEDTEVTLDQVGEQFGAEVRYLVDGVTKLEKVDYGAAAEPETFRKMLLATGN
DVRVMSIKLADRLHNMRTLGVMRREKQERIAKVTRDVLIPLAERLGVQALKSELEDLVFA
VMHPEEYAHTRELVQENAARADDPLAAVADEVRGVLREADIQAEVLIRPRHFVSVHRVSR
KRGTLRGADFGRLLVLVQEDADCYAVLGELHTCMTPVVSEFKDFIAVPKFNLYQSLHTAV
ARAEDGQVVEVLIRTHQMHKVAEAGVVALGNPYAPPAEEQSAGDGERADPTRPGWLSRLL
DWQRGAPDPDTFWSTLREDLAQDREITVFRPDGGTLGLPDGATCVDAAYAQYGEDAHATI
GARVNGRLAPMSTVLRDGDTVQLLMGQDPASEPSREWLEHAHTPAARIAIQRRLAAHPEA
APEAQEPPRGPAAPEPHAHPDAPRPAPDAAPARPAAADVLVDPPGATVRLAGCCTPVPPD
EITGFAVRGGVVTVHRVQCAVVARMKSTGRAEVGVRWGESTGCRVTLLAESFGRPHLLAD
LTEAMALEGAEIVSATVEPPDRQRVRHSYTVVLPDAARLPALMRAMRDVAGVYDVSRAQP
QPAGA
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcggaggccgtgaatccagcgagcccgggacccgtgccgcccacggccaccggt
gccgtcacgccggcgccccgcaggaaggcccgcccccggatcgacctgcgccgcctcggc
cgggccgccctgctcggctccgccacccgcagccgtggcctgcccgacgccatcggccac
gtcgtcgaggcccaccgcgcccaccaccccgacgccgacctcgacccgctgcgccgcgcc
tacgtcctggccgagtcctcgcaccgcgggcagatgcgcaagagcggcgagccgtacatc
acccacccgctcgccgtcaccctgatcctcgccgaactgggcgcggagaccaccaccctg
accgcctcgctcctccacgacaccgtcgaagacaccgaggtgacgctcgatcaggtcggc
gagcagttcggcgccgaggtccgctacctcgtggacggcgtcaccaagctggagaaggtc
gactacggcgccgccgccgagcccgagaccttccgcaagatgctcctcgccaccggcaac
gacgtccgcgtgatgtcgatcaaactcgccgaccggctgcacaacatgcgcaccctcggt
gtcatgcgccgcgagaagcaggaacgcatcgccaaggtcacccgcgacgtcctcatcccg
ctcgccgaacggctcggcgtgcaggcgctcaagtccgagctggaggacctcgtcttcgcg
gtcatgcaccccgaggagtacgcgcacacgcgggagctggtccaggagaacgccgcccgc
gcggacgacccgctcgccgcggtcgccgacgaggtgcggggcgtgctgcgcgaggccgac
atccaggccgaagtcctcatccgcccgcgccacttcgtctcggtacaccgtgtctcccgc
aagcgcggcacgctccgcggcgcggacttcggccgcctcctggtgctcgtccaggaggac
gccgactgctacgccgtcctcggtgagctgcacacctgtatgacgcccgtcgtctcggag
ttcaaggacttcatcgccgtccccaagttcaacctctaccagtcgctgcacacggcggtg
gcccgcgcggaggacggccaggtcgtcgaagtcctcatccgcacccaccagatgcacaag
gtcgccgaggccggtgtggtcgcgctcggcaacccgtacgcgcctccggcggaggagcag
agcgcgggcgacggcgagcgcgccgaccccacccggcccggctggctctcccggctgctc
gactggcagcgcggcgcccccgaccccgacacgttctggtccaccctccgcgaggacctc
gcccaggaccgcgagatcaccgtcttccgccccgacggcggcaccctcggcctccccgac
ggcgcgacctgtgtcgacgccgcctacgcccagtacggcgaggacgcccacgcgaccatc
ggcgcccgggtcaacgggcggttggcgcccatgagcacggtgctgcgggacggcgacacc
gtgcagctcctgatgggccaggaccccgcctccgagccctccagggagtggctggagcac
gcccacaccccggccgcgcggatcgccatccagcgccggctcgccgcccacccggaagcg
gcgcccgaggctcaggagccgccccgcggacccgccgcacccgagccccacgcccacccg
gacgcgccgcgaccggccccggacgccgcacccgcccgccccgccgccgccgacgtcctc
gtcgacccaccgggcgcgaccgtacggctggccggctgctgcacccccgtaccgccggac
gagatcaccggtttcgccgtgcgcggaggcgtggtgaccgtgcaccgcgtccagtgcgcg
gtggtggcgcgcatgaagagcaccgggcgcgcggaggtcggtgtgcgctggggggagagc
accggatgccgggtgaccctgctcgccgaatcgttcggccgcccgcacctcctggccgac
ctcaccgaggccatggccctcgaaggcgccgaaatcgtctccgccaccgtcgaacccccg
gaccgtcagcgggtccggcacagctacaccgtcgtactcccggacgccgcccggctgccc
gccctcatgcgcgccatgcgcgacgtggccggcgtctacgacgtcagccgggcccagccg
cagccggccggcgcgtga

DBGET integrated database retrieval system