KEGG   Streptomyces coelicolor: SCO5868Help
Entry
SCO5868           CDS       T00085                                 

Gene name
dut
Definition
(RefSeq) deoxyuridine 5'-triphosphate nucleotidohydrolase
  KO
K01520  
dUTP pyrophosphatase [EC:3.6.1.23]
Organism
sco  Streptomyces coelicolor
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SCO5868 (dut)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.23  dUTP diphosphatase
     SCO5868 (dut)
DNA repair and recombination proteins [BR:sco03400]
 Eukaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    SCO5868 (dut)
 Prokaryotic Type
    SCO5868 (dut)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
6423998..6424549
Genome map
AA seq 183 aa AA seqDB search
MSRAGLEVLIRRVDPDVPLPAYAQPGDAGADLRTTVERELAPGERAVLPTGVSVALPEGY
AAFVHPRSGLAARCGVALVNAPGTIDAGYRGEIKVIVVNLDPRESVRFERFDRIAQLVVQ
QVERVRFRQVAELPGSARAEGGFGSTGGHAGLDPASGTSGQVAEGGPTGGNRYASVVSDR
EGQ
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgcgccggcctggaggtgctcatccgccgcgtcgaccccgacgtaccgctcccg
gcgtacgcgcagcccggggacgcgggcgccgacctgcgcaccaccgtcgagcgggagctg
gcgcccggtgaacgcgccgtcctgcccaccggcgtgtctgtcgccctccccgaggggtac
gcggccttcgtgcacccacgttccggactggccgcacgctgcggcgtcgccctggtgaat
gccccggggacgattgatgccgggtaccgtggggagatcaaggtgatcgtggtgaatctc
gacccgcgcgagagcgtgcggttcgagcgcttcgaccggattgcccaactggtcgtccag
caggtcgagagggtccgcttccgtcaggtcgcggaacttcccggctcggcgcgggccgag
gggggcttcgggtccaccggcggccacgccgggctggaccctgcaagcggcacaagcggt
caggtcgccgaaggcggcccgacgggtgggaatcgatacgcttcggtcgtatccgaccgg
gaaggacagtga

DBGET integrated database retrieval system