KEGG   Streptomyces coelicolor: SCO5877Help
Entry
SCO5877           CDS       T00085                                 

Gene name
redD
Definition
(RefSeq) transcriptional regulator RedD
Organism
sco  Streptomyces coelicolor
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BTAD Trans_reg_C TPR_6
Motif
Other DBs
NCBI-GeneID: 1101319
NCBI-ProteinID: NP_629999
Kitasato: SCO5877
UniProt: P16922
Position
6432566..6433618
Genome map
AA seq 350 aa AA seqDB search
MTGGGVLATMDPVRKLVRSQPKIGRHPVAAGQDGRDRHPIRSWECGERARTARTGRTVGR
AADPSDHGPSLYNFGGCVEINILGPVSIDTSHSGGGIRAGKVRTLVATLAIDAGRAVSLA
DLVDELWGATPPDNVLNALQAHAARARKVLNERACPERAGGILRSVLGGYLLEIDPQCVD
GNRFLRLVSQGAALLPADPTRAVELLETGLRLWRGPALIDAGEGRRCRGAAALFEERRLT
ALEDLISAMFLRGGEAQAIAMLQQLVAQYPLRERFCELLMVGLYRVGRQGDALESYRLAR
KRLDDELGVQPGALLRRRHAEILAQDPVLKVPSALWREPYAPADTSLLSA
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgacgggtgggggagtgcttgccacgatggacccggttcgaaaactggtccggagccag
ccaaagatcgggcggcaccccgtcgcggccggtcaggacggccgcgaccggcaccccatc
cgctcatgggagtgcggagaacgcgcgaggacggcccggaccggcaggacggtcggccgc
gcggccgacccctcggaccacggacccagcctgtacaacttcgggggatgcgtggaaatc
aacatattgggacccgtatcgatcgacacgtcgcacagcggcggcggcatccgggccggc
aaggtccgtacgctggtggcgacgctcgccatcgacgcgggccgcgccgtgtcgctcgcg
gacctggtggacgaactgtggggcgcgaccccgcccgacaacgtcctcaacgccctccag
gcgcatgccgctcgggcccggaaagtgctcaacgagcgtgcctgccccgagcgggcgggc
ggcatcctgcgttccgtgctcggcggctacctgctggagatcgacccgcagtgcgtggac
ggcaaccgcttcctgagactcgtctcgcagggcgccgccctgctccccgccgaccccacg
cgcgccgtcgaactgctggagaccggtctgcggctgtggcgcgggcccgccctcatcgac
gcgggtgagggcaggcgctgccggggcgccgcggccctgttcgaggaacgcaggctcacg
gccctggaggatctcatcagcgcgatgttcctgcgcggcggcgaggcccaggcgatcgcc
atgctccagcagctggtggcgcagtacccactgcgcgagcggttctgcgagctgctgatg
gtcggcctctaccgggtgggacgtcagggagacgccctggagtcgtaccgcctggccagg
aagcggctcgacgacgaactgggggtccagccgggcgcgctgctgcgccgacggcacgcc
gagatcctcgcgcaggacccggtcctcaaggtgccctccgcgctgtggcgcgaaccgtac
gcgcccgccgacaccagcctgctcagcgcctga

DBGET integrated database retrieval system