KEGG   Streptomyces coelicolor: SCO5879Help
Entry
SCO5879           CDS       T00085                                 

Gene name
redW
Definition
(RefSeq) acyl-coa dehydrogenase RedW
Organism
sco  Streptomyces coelicolor
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
6436613..6437788
Genome map
AA seq 391 aa AA seqDB search
MNFDFDAGFDTETRELRDMVVRFARRELDSSGRFDDAEDFRRRWLLAGKQGLTGTTVPGE
YGGSGLDAVSAAATMEALGYGCADTGFAFSVAAHLFAAVMPIVEFGTGEQRAAWLPALCS
GERIAAHAITEPEAGSDALHLRTRARPVDDGHVLSGSKCFITNAPVADVFVVQAATDPRG
GFFGLTTFLVEASTPGLTVGRPYDKVGLRGSPTADVHFDDCYVPAGAVLGAEGSGASIFS
SSMKWERTCLFAAYLGAMRRVLESTVDHVRDREQFGSPIGGFQAVSHRIVDMLGRYEGAR
LLLYRAARSLSDGTADEVGPALAKIAVSEAAVQLGLDAVQLRGGLGIMDGEAETLLRDAL
PARIFSGTNEIQKNNVARALGLGRRRPAARR
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcgacttcgacgccgggttcgacaccgagaccagggaactgcgcgacatggtc
gtgcggttcgcccggcgcgagctggactcctccggccgtttcgatgatgccgaggacttc
cggcggcgctggctgctggccggcaagcagggcctgaccggcaccaccgtgcccggtgag
tacggcggcagcggactggacgcggtgtccgcggccgccacgatggaggcgctcggctac
ggctgcgcggacaccggcttcgccttctcggtcgccgcgcatctgttcgccgccgtcatg
ccgatcgtcgagttcggcaccggggagcagcgtgccgcgtggttgccggccctgtgctcc
ggcgagcggatcgccgcgcacgccatcaccgagccggaggccggttcggacgcgctgcac
ctgcgcacccgcgcccgccccgtcgacgacggccatgtgctcagcggctccaagtgcttc
atcaccaacgcccccgtggccgacgtgttcgtggtgcaggccgccaccgatccgcggggc
ggcttcttcggactgaccaccttcctggtcgaggcatccacaccgggactcacggtgggc
cgtccgtacgacaaggtgggcctgcgcggctcccccaccgccgacgtccacttcgacgac
tgctacgtcccggccggcgcggtgctgggcgccgagggctccggggcgagcatcttctcc
tcctcgatgaagtgggagcgcacctgcctcttcgcggcctacctcggagcgatgcgccgg
gtgctggagtccacggtggaccacgtccgggaccgcgagcagttcggctcgcccatcggc
ggcttccaggcggtcagccaccgcatcgtcgacatgctgggccgctacgagggggcccgg
ctgctcctgtaccgcgccgcccgttccctgtccgacggcacggcggacgaggtcggcccg
gctctcgcgaagatcgcggtcagtgaggcggccgtacaactcggactggacgccgtccag
ttgagaggtgggctggggatcatggacggggaggcggagaccctgctgcgggacgcgctg
cccgcccggatcttctccggcaccaacgagatccagaagaacaacgtcgcgcgagcgctg
ggcctcgggcgccggcgtcccgcggcccgccgctga

DBGET integrated database retrieval system