KEGG   Streptomyces coelicolor: SCO5889Help
Entry
SCO5889           CDS       T00085                                 

Gene name
redO, SC3F7.09
Definition
(RefSeq) hypothetical protein
Organism
sco  Streptomyces coelicolor
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
6445654..6445917
Genome map
AA seq 87 aa AA seqDB search
MTPRKLITDYIADAWMGGDAEGLEPDTPIAELNIIDSAAIFDLVHYLQGEFRVTVPLPEV
TLQNFRSVNAICALVDRLRQNEGGTAA
NT seq 264 nt NT seq  +upstreamnt  +downstreamnt
atgactcctcggaaactgatcaccgactacatcgccgacgcctggatgggcggcgacgcc
gaaggcctggagccggacacccccatcgcggagctgaacatcatcgactccgccgccatc
ttcgacctcgtccactacctgcagggcgagttccgcgtcacggtgccgctgccggaggtc
accctgcagaacttcaggtccgtcaacgcgatctgcgccctggtcgaccggctccggcag
aacgaggggggaaccgcggcatga

DBGET integrated database retrieval system