KEGG   Streptomyces coelicolor: SCO5975Help
Entry
SCO5975           CDS       T00085                                 

Gene name
arcA2, StBAC16H6.10
Definition
(RefSeq) arginine deiminase
  KO
K01478  
arginine deiminase [EC:3.5.3.6]
Organism
sco  Streptomyces coelicolor
Pathway
Arginine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    SCO5975 (arcA2)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.6  arginine deiminase
     SCO5975 (arcA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
6549048..6550304
Genome map
AA seq 418 aa AA seqDB search
MNGRRSGQDGDMGFQVDSEAGRLTRVILHRPDLELKRLTPSNKDALLFDDVLWVRRARAE
HDGFADVLRDRGVAVHLFGDLLTETLDVPAARRLVLDRVFDEKEYGVLATDHLRAAFETL
PAHELAEWLVGGMTKREFLDAHPEPTSVRFHAMELDDFLLGPLPNHLFTRDTSAWIYDGV
SINAMRWPARQRETVHFEAIYRHHPLFRDESFHLWSEGQADYPSTIEGGDVLVIGNGAVL
IGMSERTTPQAVEMLAHKLFAAGSARTIVALDMPKRRAFMHLDTVMTMVDGDTFTQYAGL
GMLRSYTIEPGAGEKDLKVTDHPPEHMHRAMAAALGLGEIRVLTATQDVHAAEREQWDDG
CNVLAVEPGVVVAYERNATTNTHLRKQGIEVIEIPGSELGRGRGGPRCMSCPVERGPV
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgggcgccggagtggtcaggatggagacatgggattccaagtcgactccgaagcc
gggcggctcacccgcgtcatcctgcaccggccggatctcgagctcaaaaggctcaccccc
agcaacaaggacgcccttctcttcgacgacgtgctgtgggtgcgccgggcgcgcgccgag
cacgacgggttcgccgacgtgctccgcgaccgcggggtggcggtgcacctcttcggcgac
ctgctcaccgagaccctggacgtcccggccgcacggcggctcgtcctggaccgggtcttc
gacgagaaggagtacggagtactggccacggaccacctccgggccgccttcgagaccctg
cccgcccacgagctggccgagtggctggtcggcggcatgaccaagcgggagttcctggac
gcacacccggagccgacctccgtgcgcttccacgccatggagctggacgacttcctgctc
ggcccgctgcccaaccacctcttcacccgggacacctcggcctggatctacgacggcgtc
tccatcaacgccatgcgctggcccgcccggcagcgcgagacggtccacttcgaggcgatc
taccggcaccacccgctgttccgcgacgagagcttccacctctggtccgaggggcaggcc
gactacccctccaccatcgagggcggcgacgtcctcgtcatcggcaacggcgccgtgctc
atcggcatgagcgagcgcaccacgccccaggccgtcgagatgctcgcgcacaagctgttc
gccgccgggtccgcccggaccatcgtggccctcgacatgcccaagcggcgcgccttcatg
cacctggacacggtgatgacgatggtcgacggggacaccttcacccagtacgccgggctc
ggcatgctccgctcctacaccatcgagccgggcgccggggagaaggacctgaaggtcacc
gaccacccgccggagcacatgcaccgcgccatggccgccgctctcggcctcggcgagatc
cgggtcctcaccgccacccaggacgtgcacgcggccgagcgcgagcagtgggacgacggc
tgcaacgtcctggccgtcgagccgggcgtcgtcgtcgcctacgaacgcaacgccaccacc
aacacccacctgcgcaaacagggcatcgaggtgatcgagatcccgggcagcgaactgggc
cggggccggggcggaccgcgctgcatgagctgccccgtggagcgagggcccgtataa

DBGET integrated database retrieval system