KEGG   Streptomyces coelicolor: SCO5976Help
Entry
SCO5976           CDS       T00085                                 

Gene name
arcB, StBAC16H6.11
Definition
(RefSeq) ornithine carbamoyltransferase
  KO
K00611  
ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
sco  Streptomyces coelicolor
Pathway
Arginine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SCO5976 (arcB)
  Amino acid metabolism
   00220 Arginine biosynthesis
    SCO5976 (arcB)
Enzymes [BR:sco01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     SCO5976 (arcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
6550399..6551406
Genome map
AA seq 335 aa AA seqDB search
MATVPTALAGRHFLKELDFTEEEFRGLIELAAELKAAKRAGTETRYLQGRNIALIFEKTS
TRTRCAFEVAAADQGASTTYLDPAGSQIGHKESVKDTARVLGRMFDGIEYRGDSQTKVEE
LAAFAGVPVYNGLTDDWHPTQMLADVLTMTEHSDRPLREITFAYLGDARFNMGNSYLVTG
ALLGMDVRIVAPKSYWPAQEVVDRAHRLAAASGARITLTEDVAEGVRGAGFVVTDVWVSM
GEPKEVWAERIKALAPYAVTMDVLRATGNPDVRFLHCLPAFHDLGTKVGQEIFEAHGLDS
LEVTDEVFESAHSVVFDEAENRLHTIKAVLVATLA
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggcgacagtcccgaccgccctcgccggccgccacttcctcaaggagctggacttcacc
gaggaggagttccgcggcctgatcgagctggccgcggagctgaaggccgcgaagcgggcc
gggacggagacgcggtacctccagggcaggaacatcgcgctgatcttcgagaagacctcg
acgcgcacccgctgcgcgttcgaggtcgccgccgccgaccagggcgcctccacgacgtac
ctcgacccggccgggtcgcagatcggccacaaggagtccgtgaaggacaccgcccgcgtc
ctcggccgcatgttcgacggtatcgagtaccgcggcgacagccagaccaaggtcgaggaa
ctggcggccttcgcgggcgtccccgtctacaacggcctgaccgacgactggcaccccacc
cagatgctcgccgacgtgctcacgatgaccgagcacagcgaccgccccctgcgggagatc
accttcgcctacctcggcgacgcccgcttcaacatgggcaactcctacctggtcaccggc
gccctgctcggcatggacgtgcgcatcgtcgccccgaagtcctactggcccgcccaggag
gtcgtcgaccgggcgcaccggctcgccgcggccagcggggcgcgcatcaccctcaccgag
gacgtggccgaaggggtgcggggcgccgggttcgtcgtcacggacgtctgggtctccatg
ggcgagcccaaggaggtctgggcggagcggatcaaggcactcgcgccctacgccgtgacc
atggacgtgctgcgcgccaccggcaacccggacgtcaggttcctgcactgcctgcccgcc
ttccacgacctgggcaccaaggtgggccaggagatcttcgaggcccacgggctcgactcc
ctggaggtcaccgacgaggtcttcgagtcggcgcactcggtcgtcttcgacgaggcggag
aaccgcctgcacaccatcaaggccgtcctcgtcgccaccctcgcctga

DBGET integrated database retrieval system