KEGG   Streptomyces coelicolor: SCO5983Help
Entry
SCO5983           CDS       T00085                                 

Gene name
StBAC16H6.18c
Definition
(RefSeq) fatty acid-CoA ligase
  KO
K08295  
2-aminobenzoate-CoA ligase [EC:6.2.1.32]
Organism
sco  Streptomyces coelicolor
Pathway
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sco00001]
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SCO5983 (StBAC16H6.18c)
Enzymes [BR:sco01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.32  anthranilate---CoA ligase
     SCO5983 (StBAC16H6.18c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(6558619..6560310)
Genome map
AA seq 563 aa AA seqDB search
MADPRRADPHRSAHVDTFARDHLPPPEQWPELLFDLPELRYPERLNCAAELLTGPPGDRP
VFRTASGETWTYQGLRDRVDRIAHVLTGDLGVVPGNRVLLRGPTGPWLAACWLAVLKAGA
VAVTVLAQQRPHELRAICEIARVRHALCDVRAVDDLAKAEIAGLRITTYGGDAPDDLHSR
TASDAVSPTPYRAVDTAADDVALIAFTSGTTGRPKGCMHFHRDVLAIADTFSAQVLKPRS
DDLFAGSPPLGFTFGLGGLVVFPMRAGASALLLEQAGPKQLLPAVAEHRVSVLFTAPTAY
RTMLDELDGYDVSSLRRCVSAGENLPAATWRAWHERTGLRVINGIGATELLHIFVSAADD
DIRPGTTGVPVPGWHARVQDAHGAPVPDGEPGLLAVRGPVGCRYLADPRQREYVQDGWNV
TGDTYVREPDGYFRYVARADDMIISAGYNIAGPEVEDALLRHPDVVEAAVVGRPDRHRGQ
VVVAHAVLRDGAARDADALRAFLRAELAPYKCPREILFPDALPRTATGKLQRYRLLDPAG
PGPSPLPRDSSESPGRPGATPTT
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atggccgatcctcgccgcgcggacccgcaccgctccgcccacgtcgacaccttcgcgcgc
gaccacctgccgccccccgagcagtggcccgagctgctcttcgacctgccggagctgcgc
tacccggagcggctgaactgcgccgccgagctgctcaccggcccgcccggcgaccgtccg
gtcttccgcaccgcctccggggagacctggacctaccaagggctgcgggaccgcgtcgac
cggatcgcccacgtgctcaccggcgacctcggtgtcgtcccgggcaaccgggtgctgctg
cgcggccccaccggcccgtggctggccgcgtgctggctggcggtgctgaaggcgggcgcg
gtggcggtcaccgtgctggcccagcagcgcccgcacgagctgcgcgcgatctgcgagatc
gcccgggtgcggcacgcgctgtgcgacgtccgggccgtcgacgacctcgccaaggcggag
atcgccggcctgcggatcacgacgtacggcggggacgcgccggacgacctgcacagccgc
acggcgtcggacgcggtgtccccgacgccgtaccgggccgtcgacaccgccgccgacgac
gtggcgctgatcgcgttcacgtccggcaccaccgggcgacccaaggggtgcatgcacttc
caccgcgatgtgctggcgatcgcggacaccttctccgcacaggtgctcaagccgcgctcc
gacgacctcttcgcgggcagcccgccgctcggtttcaccttcgggctcggcggtctcgtc
gtcttcccgatgcgggccggggcgagcgccctgctgctcgaacaggcgggtcccaagcag
ctgttgccggcggtcgcggagcaccgggtgtcggtgctgttcaccgcgccgacggcgtac
cgcacgatgctcgacgagctggacgggtacgacgtgagcagcctgaggcgctgcgtctcg
gcgggcgagaacctgcccgcggccacctggcgggcctggcacgagcgcaccgggctgcgc
gtcatcaacggcatcggcgccaccgagctgctgcacatcttcgtgtccgccgcggacgac
gacatcaggcccgggacgacgggcgttccggtgccggggtggcacgcgcgcgtgcaggac
gcgcacggcgcacccgtgcccgacggggagcccggactgctggcggtgcgcgggccggtg
ggctgccggtacctcgccgacccgcgccagcgggagtacgtgcaagacggctggaacgtc
accggggacacctacgtccgcgagcccgacgggtacttccggtacgtggcacgcgccgac
gacatgatcatctccgccgggtacaacatcgccgggcccgaggtggaggacgcgttgctg
cgccacccggacgtggtggaggcggcggtggtgggccgtcccgaccggcaccgggggcag
gtcgtggtcgcgcacgcggtgctgcgggacggggccgcgcgggacgcggacgcgctgcgc
gcgttcctgcgcgcggagctggcgccgtacaagtgtccgcgggagatcctcttcccggac
gcgctgccgcgcacggcgaccggcaagctccagcgctaccgcctcctcgacccggccggt
ccgggcccctccccccttccccgggactcgtccgaatcccctgggcggccgggcgcgacg
ccgacgacataa

DBGET integrated database retrieval system