KEGG   Streptomyces coelicolor: SCO6035Help
Entry
SCO6035           CDS       T00085                                 

Gene name
SC1C3.23
Definition
(RefSeq) lysine/ornithine decarboxylase
  KO
K01581  
ornithine decarboxylase [EC:4.1.1.17]
Organism
sco  Streptomyces coelicolor
Pathway
Arginine and proline metabolism
Glutathione metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SCO6035 (SC1C3.23)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SCO6035 (SC1C3.23)
Enzymes [BR:sco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.17  ornithine decarboxylase
     SCO6035 (SC1C3.23)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
6625434..6626642
Genome map
AA seq 402 aa AA seqDB search
MSPLTAADLGAPLAAALAAATEDRLVYDLAGIERRHDTLRNELPGVHVRFAMKACPVDEV
LAALAGRGAGADAASPGEVEQALRAGVPAGRVHYGNTVKSDRNIAEAHRLGVRTFATDSL
QDVAALAVHAPGARVFCRVATGGAGALWGLSNKFGCPPGDAVRVLVAARDAGLVPAGLSV
HVGSQQMTSEAWHGAVDDLGDVLRALGRHGIRVDHVNLGGGLPALGYRDRHGAPLDPPLD
KIFAVIREGMDELRRIHGGHLDFVVEPGRHLVADHGAIRAHVVRLTERRAADGERQHWLY
LSCGKFNGLYEMDALQYRLVFPGHPDGPCVPAVVAGPTCDSDDAYSHEEGLVPVPAALAS
GDPVWVLSCGAYATSYTTRGFNGFAPLPYAFAGRPERTGADD
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
gtgagccccctgacggccgcggacctcggcgcacccctggccgccgcgctcgccgccgcc
accgaggaccggctcgtgtacgacctggccggcatcgagcggcgccacgacacgctgcgg
aacgaactgccgggcgtgcacgtgcggttcgcgatgaaggcctgcccggtcgacgaggta
ctcgccgccctggcaggccggggcgccggtgccgacgcggcgagccccggcgaggtcgag
caggcgctgcgggccggggtgccggccggccgcgtgcactacggcaacaccgtcaagtcc
gaccggaacatcgccgaggcccaccggctcggcgtgcgcaccttcgccaccgacagcctc
caggacgtcgccgccctcgccgtccacgcccccggcgcccgggtgttctgccgggtggcg
accggcggggcgggcgcgctgtgggggctgagcaacaagttcggctgcccgcccggcgac
gccgtccgagtgctggtggcggcccgggacgccggtctggtgccggccggcctgtccgtg
cacgtcgggtcccagcagatgacgagcgaggcctggcacggcgccgtcgacgacctgggc
gacgtactgcgcgcactcggccggcacggcatccgcgtcgaccacgtcaacctcggcggc
ggactgcccgcgctcggctaccgcgaccggcacggcgcccccctcgacccaccgctggac
aagatcttcgcggtgatccgggagggcatggacgagctgcgccggatccacggcggccac
ctggacttcgtcgtcgaacccgggcggcacctcgtcgccgaccacggcgcgatccgcgcc
cacgtcgtccgcctcaccgagcgccgggcggccgacggcgagcggcagcactggctctac
ctgagctgcggcaagttcaacggcctgtacgagatggacgccctgcagtaccggctggtc
ttcccgggccaccccgacggcccctgcgtcccggccgtggtcgccggacccacctgcgac
agcgacgacgcctactcccacgaggaggggctggtcccggtgcccgcggcactggcctcg
ggcgacccggtctgggtgctgtcctgcggcgcctacgcgaccagctacacgacccggggc
ttcaacggcttcgccccgctcccgtacgccttcgcgggccgcccggagaggaccggcgcc
gatgactga

DBGET integrated database retrieval system