KEGG   Streptomyces coelicolor: SCO6058Help
Entry
SCO6058           CDS       T00085                                 

Gene name
SC9B1.05
Definition
(RefSeq) hypothetical protein
  KO
K00082  
5-amino-6-(5-phosphoribosylamino)uracil reductase [EC:1.1.1.193]
Organism
sco  Streptomyces coelicolor
Pathway
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    SCO6058 (SC9B1.05)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.193  5-amino-6-(5-phosphoribosylamino)uracil reductase
     SCO6058 (SC9B1.05)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
6650674..6651471
Genome map
AA seq 265 aa AA seqDB search
MRRLFPVSPATDPTAGPGGGPETDREWSLAELAAAYAYPEPDAHRRTWLRANMVSTLDGA
AQHDGRSQPISSAADMRVFGTLRALADVVIAGAETVRQEGYRPGRARADFAEARRAAGQA
PVPVIAVVSASLELDFSLPLFTSPAVPTLVLTGAAAAPDRIAAAERAGARVVIAGDGVGV
DPARALGALAELGHTRLLTEGGPRLLGQFVAAGVLDELCLTVSPMLTAGDAQRIAGGPAV
GVPRRFALASLLEEEGFLFSRYRRD
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgcgacgcctgttccccgtgtcccccgcgaccgatccgaccgccggcccgggcggcggc
cccgagaccgaccgggagtggagcctggcggagctggccgccgcctacgcgtaccccgag
cccgacgcgcaccgccggacgtggctgcgggccaacatggtctccaccctcgacggcgcc
gcccagcacgacggccgctcccagcccatctccagcgcggccgacatgcgggtcttcggc
accctgcgggcgctggcggacgtggtgatcgccggcgccgagaccgtacggcaggagggg
taccgcccggggcgcgcgcgggcggatttcgccgaggcgcggcgggcggccgggcaggcg
cccgtgccggtgatcgcggtggtcagcgcgagcctggagctggacttctccctgccgctg
ttcacctccccggccgtgcccacgctggtcctgaccggcgccgccgcggcccccgaccgg
atcgccgccgcggagcgggccggggcccgggtggtgatcgcgggagacggcgtcggggtg
gacccggcccgtgcgctcggggcgctcgcggagctggggcacacccggctgctgaccgag
ggcggcccgcggctgctggggcagttcgtcgcggccggtgtgctcgacgagctgtgcctg
accgtctccccgatgctgaccgcgggggacgcgcagcggatcgcgggcggaccggcggtc
ggggtgccgaggcgattcgcactggcgtccctcctggaggaggaaggtttcctcttcagc
cggtaccggcgcgactag

DBGET integrated database retrieval system