KEGG   Streptomyces coelicolor: SCO6060Help
Entry
SCO6060           CDS       T00085                                 

Gene name
murC, SC9B1.07
Definition
(RefSeq) UDP-N-acetylmuramoyl-L-alanine ligase
  KO
K01924  
UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
sco  Streptomyces coelicolor
Pathway
D-Glutamine and D-glutamate metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    SCO6060 (murC)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SCO6060 (murC)
Enzymes [BR:sco01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     SCO6060 (murC)
Peptidoglycan biosynthesis and degradation proteins [BR:sco01011]
 Precursor biosynthesis
  Amino acid ligase
   SCO6060 (murC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
6652235..6653623
Genome map
AA seq 462 aa AA seqDB search
MAPGLPTAMDRPHFIGIGGAGMSGIAKILAQRGAEVAGSDAKESATADALRALGATVHIG
HAAEHLAADASCVVVSSAIREDNPELVRAAELGIPVVHRSDALAALMNGLRPIAVAGTHG
KTTTTSMLAVSLSELDLGPSYAIGGDLDAPGSNALHGEGEIFVAEADESDRSFHKYAPEV
AIVLNVELDHHANYASMDEIYESFETFAGKIVPGGTLVIAADHEGARELTRRLAGRVRTV
TYGESEDADVRILSVVPQGLKSEVTVVLDGAELTFAVSVPGRHYAHNAVAALAAGAALGV
PAAELAPALAAYTGVKRRLQLKGEAAGVQVVDSYAHHPTEMTADLEAMRAAVGDARILVL
FQPHLFSRTQELGKEMGQALALADASVVLDIYPAREDPIPGVTSELIVEAARAAGADVTP
VHDKDASPALVAGMAKAGDLVLTMGAGDVTDLGPRILDELSK
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggcacccggccttcccaccgccatggaccgaccgcacttcatcggcatcggcggcgcc
ggaatgtcgggcatcgccaagatcctcgcccagcgcggcgccgaggtggcgggcagcgac
gccaaggagtccgcgaccgccgacgcgctgcgcgccctgggcgccaccgtgcacatcggg
cacgcggcggagcacctcgccgccgacgcgagctgcgtggtcgtgtcctcggccatccgc
gaggacaatccggagctggtccgcgccgccgagctgggcatcccggtcgtgcaccgctcc
gacgccctcgccgccctgatgaacggcctgcgccccatcgcggtcgccggcacccacggc
aagaccaccaccacctcgatgctggcggtctccctgtccgagctggacctgggcccgtcg
tacgcgatcggcggcgacctggacgcccccggctccaacgccctgcacggcgaaggcgag
atcttcgtcgccgaggcggacgaaagcgaccgcagcttccacaagtacgctcccgaggtc
gccatcgtcctcaacgtcgagctggaccaccacgccaactacgcctcgatggacgagatc
tacgagtccttcgagaccttcgccggcaagatcgtccccggcggcaccctggtgatcgcg
gccgaccacgagggcgcccgggagctgacccgacggctggcaggccgggtgcggacggtg
acgtacggagagtccgaggacgccgacgtgcgcatcctgtccgtcgtcccgcagggcctc
aagagcgaggtcaccgtcgtcctggacggcgccgagctgaccttcgccgtctccgtcccc
ggccgccactacgcccacaacgccgtcgccgccctcgccgcgggcgccgccctcggcgtc
cccgccgccgagctggcccccgcgctggccgcctacacgggcgtcaagcggcgcctccag
ctcaagggcgaggcggccggcgtccaggtcgtcgactcctacgcgcaccaccccaccgag
atgaccgccgacctggaggccatgcgcgccgcggtcggcgacgcccgcatcctggtcctc
ttccagccgcacctcttctcccgcacccaggagctgggcaaggagatgggccaggccctg
gccctcgcggacgcctcggtcgtcctcgacatctacccggcccgcgaggacccgatcccg
ggcgtcaccagcgagctgatcgtcgaggcggcccgcgccgccggcgccgacgtcacaccg
gtccacgacaaggacgcctcgcccgcgctggtcgcgggaatggcgaaggccggtgatctc
gttctcaccatgggcgcgggcgatgtcaccgacctcggaccgcgcatcctggacgagctg
tcgaagtaa

DBGET integrated database retrieval system