KEGG   Streptomyces coelicolor: SCO6075Help
Entry
SCO6075           CDS       T00085                                 

Gene name
SC9B1.22c
Definition
(RefSeq) hypothetical protein
  KO
K03651  
3',5'-cyclic-AMP phosphodiesterase [EC:3.1.4.53]
Organism
sco  Streptomyces coelicolor
Pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SCO6075 (SC9B1.22c)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.53  3',5'-cyclic-AMP phosphodiesterase
     SCO6075 (SC9B1.22c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(6669117..6669938)
Genome map
AA seq 273 aa AA seqDB search
MYVTQALTSGVSRSGRPEEADTVLVLAHISDLHLDGSPRATERAERVRERLWRLPGRVDA
LLVTGDIADHGTEAEYEEAARVLGLRDGSAPFPVLTCPGNHDSRAPYRKALLGRPAADGP
ANEVHVFDGGAVLMCDSSIPGSDEGELDGETYDWIEASLDGLDDGLPALLAFHHPPTPVH
HPLPDSYRLRHPERLAALLERRPGIAGLITGHAHSPAATVFAGRPLVVGPGVTWTLRLPW
EGEQVADRDAPVGLAFHVLDDAGRLTSHFRTVT
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
ttgtatgtcactcaagcattaacatcgggggtgtcgcggtccgggcgcccggaggaggcc
gacaccgtgctcgtactcgcgcacatcagcgatctgcacctggacggaagcccgcgggcg
acggagcgcgccgagcgggtgcgcgagaggctgtggcggctgcctgggcgggtggacgcg
ctgctggtcaccggggacatcgcggaccacggcacggaggcggagtacgaggaggccgcc
cgcgtcctgggcctgcgggacggctccgcgccgttccccgtactgacctgcccgggcaac
cacgacagccgcgccccctaccgcaaggccctgctcggccgccccgccgccgacggcccc
gccaacgaggtgcacgtcttcgacggcggcgccgtcctgatgtgcgactccagcatcccg
ggcagcgacgagggggagctggacggggagacgtacgactggatcgaggcctcgctcgac
ggtctcgacgacggccttccggccctgctcgccttccaccacccgcccacgcccgtgcac
catcccctgcccgactcctaccggctgcgccaccccgagcgcctggccgcgctgctggag
cgcaggcccgggatcgccgggctgatcacggggcacgcgcactcgcccgcggccaccgtg
ttcgccgggcggccgctggtggtgggacccggggtgacgtggacgctgcggctgccctgg
gagggcgagcaggtcgcggaccgggacgcgccggtcgggctcgccttccacgtgctggac
gacgccggacggctcacgagccacttccgcacggtcacgtga

DBGET integrated database retrieval system