KEGG   Streptomyces coelicolor: SCO6075Help
Entry
SCO6075           CDS       T00085                                 

Gene name
SC9B1.22c
Definition
(RefSeq) hypothetical protein
Organism
sco  Streptomyces coelicolor
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(6669117..6669938)
Genome map
AA seq 273 aa AA seqDB search
MYVTQALTSGVSRSGRPEEADTVLVLAHISDLHLDGSPRATERAERVRERLWRLPGRVDA
LLVTGDIADHGTEAEYEEAARVLGLRDGSAPFPVLTCPGNHDSRAPYRKALLGRPAADGP
ANEVHVFDGGAVLMCDSSIPGSDEGELDGETYDWIEASLDGLDDGLPALLAFHHPPTPVH
HPLPDSYRLRHPERLAALLERRPGIAGLITGHAHSPAATVFAGRPLVVGPGVTWTLRLPW
EGEQVADRDAPVGLAFHVLDDAGRLTSHFRTVT
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
ttgtatgtcactcaagcattaacatcgggggtgtcgcggtccgggcgcccggaggaggcc
gacaccgtgctcgtactcgcgcacatcagcgatctgcacctggacggaagcccgcgggcg
acggagcgcgccgagcgggtgcgcgagaggctgtggcggctgcctgggcgggtggacgcg
ctgctggtcaccggggacatcgcggaccacggcacggaggcggagtacgaggaggccgcc
cgcgtcctgggcctgcgggacggctccgcgccgttccccgtactgacctgcccgggcaac
cacgacagccgcgccccctaccgcaaggccctgctcggccgccccgccgccgacggcccc
gccaacgaggtgcacgtcttcgacggcggcgccgtcctgatgtgcgactccagcatcccg
ggcagcgacgagggggagctggacggggagacgtacgactggatcgaggcctcgctcgac
ggtctcgacgacggccttccggccctgctcgccttccaccacccgcccacgcccgtgcac
catcccctgcccgactcctaccggctgcgccaccccgagcgcctggccgcgctgctggag
cgcaggcccgggatcgccgggctgatcacggggcacgcgcactcgcccgcggccaccgtg
ttcgccgggcggccgctggtggtgggacccggggtgacgtggacgctgcggctgccctgg
gagggcgagcaggtcgcggaccgggacgcgccggtcgggctcgccttccacgtgctggac
gacgccggacggctcacgagccacttccgcacggtcacgtga

DBGET integrated database retrieval system