KEGG   Streptomyces coelicolor: SCO6097Help
Entry
SCO6097           CDS       T00085                                 

Gene name
cysN, SCBAC1A6.21c
Definition
(RefSeq) sulfate adenylyltransferase subunit 1
  KO
K00956  
sulfate adenylyltransferase subunit 1 [EC:2.7.7.4]
Organism
sco  Streptomyces coelicolor
Pathway
Purine metabolism
Monobactam biosynthesis
Selenocompound metabolism
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Module
Assimilatory sulfate reduction, sulfate => H2S
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    SCO6097 (cysN)
  Nucleotide metabolism
   00230 Purine metabolism
    SCO6097 (cysN)
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    SCO6097 (cysN)
  Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    SCO6097 (cysN)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.4  sulfate adenylyltransferase
     SCO6097 (cysN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
complement(6697066..6698421)
Genome map
AA seq 451 aa AA seqDB search
MTSTTEPVEPLSVWQLSETTLLRFATAGSVDDGKSTLVGRLLHDSKSVLTDQLEAVERAS
ASRGQDVPDLALLTDGLRAEREQGITIDVAYRYFATPRRRFILADTPGHVQYTRNMVTGA
STAELTVILVDARNGVVEQTRRHAAIAALLRVPHVVLAVNKMDLVDYQESVFAAIAEEFT
AYATELGVPEVTAIPISALEGDNVVEASAVMDWYGGPTVLEHLETVPVSHDLAHCHARLP
VQYVIRPQTAEHPDYRGYAGQIAAGTFRVGDEVTVLPSGRTSKVSAIDVLGEPVDAAWTP
QSVTLLLEDDIDVSRGDLIVPSEDAPATSQDVEATVCHVADAPLTVGHRVLLKHGTRTVK
AIVKDIPARLTLDDLSLHPHPGQLVANDIGRVKVRTAEPLPADSYADSRRTGSFILIDPS
DGTTLTAGMVGESFAAPEPVKDAADADGWDF
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcaccactgaacccgtcgagccgctgtcggtctggcagctgtcggagacgacc
ctgctgcggttcgccaccgcgggctcggtcgacgacggcaagtccacgctggtcggccgc
ctgctgcacgactccaagtcggtcctcaccgaccagctggaggccgtcgaacgggcctcc
gcgagccgcggccaggacgtcccggacctcgcgctgctcaccgacggcctcagggccgag
cgcgagcagggcatcaccatcgacgtggcctaccgctacttcgccaccccgcgccgccgg
ttcatcctggccgacaccccggggcacgtgcagtacacgcggaacatggtcacgggtgcc
tccacggccgagctgacggtgatcctcgtcgacgcccgcaacggcgtcgtcgagcagacc
cgccggcacgccgcgatcgccgccctgctgcgcgtcccgcacgtcgtcctcgccgtcaac
aagatggacctggtcgactaccaggagtccgtgttcgcggcgatcgccgaggagttcacg
gcgtacgccaccgagctgggcgtcccggaggtcaccgcgatccccatctcggccctggag
ggcgacaacgtggtggaggcgtcggcggtcatggactggtacggcggcccgacggtgctg
gaacacctggagaccgtcccggtcagccacgacctggcgcactgccacgcccggctgccg
gtgcagtacgtgatccggccgcagaccgccgagcaccccgactaccgcggctacgcggga
cagatcgccgccggcaccttccgggtgggcgacgaggtcaccgtgctgccctcgggccgc
acctcgaaggtgtccgccatcgacgtgctcggcgagccggtcgacgccgcctggacgccg
cagtcggtgacgctgctcctggaggacgacatcgacgtctcgcgcggcgacctgatcgtg
cccagcgaggacgcgccggccaccagccaggacgtcgaggccaccgtctgccacgtcgcc
gacgcgccgctcaccgtgggccaccgggtgctcctcaagcacggcacccgcaccgtcaag
gcgatcgtcaaggacatcccggcccggctcacgctggacgacctgtcgctgcacccgcac
cccgggcagctggtcgccaacgacatcggccgcgtgaaggtccgcaccgccgagccgctg
cccgccgactcctacgccgactcgcggcgcaccggctcgttcatcctgatcgaccccagc
gacggcaccacgctcaccgccggcatggtcggcgagtccttcgccgcgccggagccggtc
aaggacgcggccgacgccgacgggtgggacttctga

DBGET integrated database retrieval system