KEGG   Streptomyces coelicolor: SCO6097Help
Entry
SCO6097           CDS       T00085                                 

Gene name
cysN, SCBAC1A6.21c
Definition
(RefSeq) sulfate adenylyltransferase subunit 1
  KO
K00956  sulfate adenylyltransferase subunit 1 [EC:2.7.7.4]
Organism
sco  Streptomyces coelicolor
Pathway
sco00230  Purine metabolism
sco00261  Monobactam biosynthesis
sco00450  Selenocompound metabolism
sco00920  Sulfur metabolism
sco01100  Metabolic pathways
sco01120  Microbial metabolism in diverse environments
sco01130  Biosynthesis of antibiotics
Module
sco_M00176  Assimilatory sulfate reduction, sulfate => H2S
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    SCO6097 (cysN)
  Nucleotide metabolism
   00230 Purine metabolism
    SCO6097 (cysN)
  Metabolism of other amino acids
   00450 Selenocompound metabolism
    SCO6097 (cysN)
  Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    SCO6097 (cysN)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.4  sulfate adenylyltransferase
     SCO6097 (cysN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU MMR_HSR1 GTP_EFTU_D2 cobW
Motif
Other DBs
NCBI-GeneID: 1101538
NCBI-ProteinID: NP_630205
Kitasato: SCO6097
UniProt: Q9ADG6
Position
complement(6697066..6698421)
Genome map
AA seq 451 aa AA seqDB search
MTSTTEPVEPLSVWQLSETTLLRFATAGSVDDGKSTLVGRLLHDSKSVLTDQLEAVERAS
ASRGQDVPDLALLTDGLRAEREQGITIDVAYRYFATPRRRFILADTPGHVQYTRNMVTGA
STAELTVILVDARNGVVEQTRRHAAIAALLRVPHVVLAVNKMDLVDYQESVFAAIAEEFT
AYATELGVPEVTAIPISALEGDNVVEASAVMDWYGGPTVLEHLETVPVSHDLAHCHARLP
VQYVIRPQTAEHPDYRGYAGQIAAGTFRVGDEVTVLPSGRTSKVSAIDVLGEPVDAAWTP
QSVTLLLEDDIDVSRGDLIVPSEDAPATSQDVEATVCHVADAPLTVGHRVLLKHGTRTVK
AIVKDIPARLTLDDLSLHPHPGQLVANDIGRVKVRTAEPLPADSYADSRRTGSFILIDPS
DGTTLTAGMVGESFAAPEPVKDAADADGWDF
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcaccactgaacccgtcgagccgctgtcggtctggcagctgtcggagacgacc
ctgctgcggttcgccaccgcgggctcggtcgacgacggcaagtccacgctggtcggccgc
ctgctgcacgactccaagtcggtcctcaccgaccagctggaggccgtcgaacgggcctcc
gcgagccgcggccaggacgtcccggacctcgcgctgctcaccgacggcctcagggccgag
cgcgagcagggcatcaccatcgacgtggcctaccgctacttcgccaccccgcgccgccgg
ttcatcctggccgacaccccggggcacgtgcagtacacgcggaacatggtcacgggtgcc
tccacggccgagctgacggtgatcctcgtcgacgcccgcaacggcgtcgtcgagcagacc
cgccggcacgccgcgatcgccgccctgctgcgcgtcccgcacgtcgtcctcgccgtcaac
aagatggacctggtcgactaccaggagtccgtgttcgcggcgatcgccgaggagttcacg
gcgtacgccaccgagctgggcgtcccggaggtcaccgcgatccccatctcggccctggag
ggcgacaacgtggtggaggcgtcggcggtcatggactggtacggcggcccgacggtgctg
gaacacctggagaccgtcccggtcagccacgacctggcgcactgccacgcccggctgccg
gtgcagtacgtgatccggccgcagaccgccgagcaccccgactaccgcggctacgcggga
cagatcgccgccggcaccttccgggtgggcgacgaggtcaccgtgctgccctcgggccgc
acctcgaaggtgtccgccatcgacgtgctcggcgagccggtcgacgccgcctggacgccg
cagtcggtgacgctgctcctggaggacgacatcgacgtctcgcgcggcgacctgatcgtg
cccagcgaggacgcgccggccaccagccaggacgtcgaggccaccgtctgccacgtcgcc
gacgcgccgctcaccgtgggccaccgggtgctcctcaagcacggcacccgcaccgtcaag
gcgatcgtcaaggacatcccggcccggctcacgctggacgacctgtcgctgcacccgcac
cccgggcagctggtcgccaacgacatcggccgcgtgaaggtccgcaccgccgagccgctg
cccgccgactcctacgccgactcgcggcgcaccggctcgttcatcctgatcgaccccagc
gacggcaccacgctcaccgccggcatggtcggcgagtccttcgccgcgccggagccggtc
aaggacgcggccgacgccgacgggtgggacttctga

DBGET integrated database retrieval system