KEGG   Streptomyces coelicolor: SCO6099Help
Entry
SCO6099           CDS       T00085                                 

Gene name
cysC, SCBAC1A6.23c
Definition
(RefSeq) adenylyl-sulfate kinase
  KO
K00860  
adenylylsulfate kinase [EC:2.7.1.25]
Organism
sco  Streptomyces coelicolor
Pathway
Purine metabolism
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
Assimilatory sulfate reduction, sulfate => H2S
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    SCO6099 (cysC)
  Nucleotide metabolism
   00230 Purine metabolism
    SCO6099 (cysC)
Enzymes [BR:sco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.25  adenylyl-sulfate kinase
     SCO6099 (cysC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(6699359..6699895)
Genome map
AA seq 178 aa AA seqDB search
MTTGATVWLTGLPSAGKTTIARELADRLREEGRPVELLDGDEIREFLSAGLGFDRADRHT
NVQRIGFVAELLARNGVTALVPVIAPYADSRDAVRERHGANGTAYVEVHVATPVEVCSVR
DVKGLYAKQAAGELTGLTGVDDPYEEPVAPDLRIESQDQTVQESAAAVHALLTERGLA
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
gtgacgaccggagccaccgtctggctcacggggctgcccagcgccggcaagaccaccatc
gcccgcgagctggccgaccgcctccgtgaggagggccggcccgtcgaactgctcgacggc
gacgagatccgcgagttcctctccgcgggcctcggcttcgaccgcgcggaccggcacacc
aacgtgcagcgcatcggcttcgtcgccgaactgctcgcccgcaacggcgtcacggccctg
gtcccggtgatcgcgccgtacgcggacagccgcgacgcggtgcgcgagcgtcacggggcg
aacggcacggcgtacgtcgaggtgcacgtggccacgcccgtcgaggtgtgctcggtgcgc
gacgtgaagggcctgtacgccaagcaggccgcgggtgagctgacggggctcaccggggtg
gacgacccgtacgaggagcccgtcgcacccgacctgcgcatcgagtcgcaggaccagacc
gtgcaggagtccgccgcggcggtccacgcgctgctcaccgaaaggggactggcatga

DBGET integrated database retrieval system