KEGG   Streptomyces coelicolor: SCO6100Help
Entry
SCO6100           CDS       T00085                                 

Gene name
cysH, SCBAC1A6.24c
Definition
(RefSeq) phosphoadenosine phosphosulfate reductase
  KO
K00390  
phosphoadenosine phosphosulfate reductase [EC:1.8.4.8 1.8.4.10]
Organism
sco  Streptomyces coelicolor
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
Assimilatory sulfate reduction, sulfate => H2S
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    SCO6100 (cysH)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.8  phosphoadenylyl-sulfate reductase (thioredoxin)
     SCO6100 (cysH)
    1.8.4.10  adenylyl-sulfate reductase (thioredoxin)
     SCO6100 (cysH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(6700005..6700715)
Genome map
AA seq 236 aa AA seqDB search
MTAVQEERTTEELKALAERAGRELEDATALEILRWAAETFGDRFCVTSSMEDAVVAHLAS
RALPGVDVVFLDTGYHFPETIGTRDAVEAVMDVNVITLTPRQTVAEQDAEYGPKLHDRDP
DLCCALRKVKPLEEGLAGYRAWATGLRRDESETRANTPVVGWDEKRGKVKISPIAKWSQE
DVQTYVTEHGVLTNPLLTDGYASVGCAPCTRRVLEGEDARAGRWAGRSKTECGLHG
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgacggcggttcaggaagagcgtacgaccgaggaactcaaggcgctggccgagcgggcg
ggccgcgagctggaggacgccacggcgctggaaatcctccggtgggcggccgagaccttc
ggcgaccggttctgcgtgacctcctccatggaggacgcggtcgtcgcccatctcgcctcc
cgcgccctgcccggcgtggacgtggtgttcctcgacaccggctaccacttcccggagacc
atcggcacccgcgacgcggtcgaggccgtgatggacgtgaacgtcatcacgctcaccccg
cgccagacggtcgccgagcaggacgccgagtacggcccgaagctgcacgaccgcgacccc
gacctgtgctgcgcgctgcgcaaggtgaagccgctggaggaggggctggccggctaccgg
gcctgggcgaccgggctgcgccgcgacgagtccgagacccgggcgaacacgccggtcgtg
ggctgggacgagaagcggggcaaggtgaagatctcgcccatcgccaagtggtcacaggaa
gatgtgcaaacgtacgtcaccgagcacggcgtcctcacgaacccgctgctgacggacggc
tatgcctccgtgggctgcgcgccctgcacccgtcgtgtgctggagggcgaggacgcccgc
gccggacgctgggcgggccgctcgaagaccgagtgcggactgcacggctga

DBGET integrated database retrieval system