KEGG   Streptomyces coelicolor: SCO6102Help
Entry
SCO6102           CDS       T00085                                 

Gene name
SCBAC1A6.26c
Definition
(RefSeq) nitrite/sulfite reductase
  KO
K00392  
sulfite reductase (ferredoxin) [EC:1.8.7.1]
Organism
sco  Streptomyces coelicolor
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
Assimilatory sulfate reduction, sulfate => H2S
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    SCO6102 (SCBAC1A6.26c)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.7  With an iron-sulfur protein as acceptor
    1.8.7.1  assimilatory sulfite reductase (ferredoxin)
     SCO6102 (SCBAC1A6.26c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(6700888..6702585)
Genome map
AA seq 565 aa AA seqDB search
MAATPPKPAAATPRRKVSRHRGEGQWAAGHFTPLNGNEQTKKDDDGLNVRTRIETIYSKR
GFDSIDPGDLRGRMRWWGLYTQRRQGIDGGKTAILEPEELDDRYFMLRVRIDGGALTTAQ
LRVVGEISQEFARGTADITDRQNVQYHWIRIEDVPEIWNRLEGVGLSTVTACGDTPRVMI
ASPVAGIAEDEIIDGTPALEEMKRRVLNNPAYSNLPRKFKTAISGSPVQDVVHEINDVAF
VGVEHPEHGPGFDLWVGGGLSTNPKLGVRLNAWVPIDDVPDVYEGVISIFRDYGYRRLRN
RARLKFLVADWGAEKFRQVLEDEYLKRKLTDGPAPAEPSSRWRDHIGVHRQKDGRYYVGF
APRVGRVDGTILTKVADLAEAHGSGRVRTTVEQKMIVLDVEEGRVDSLVESLEALDLSAR
PSTFRRGTMACTGIEFCKLAIVETKARGASLIDELERRLPDFDEPLTINLNGCPNACARI
QTADIGLKGQLMLDEHGEQVEGYQVHLGGALGLEAGFGRKVRGLKVTAQELPDYVERVLK
RFQAEREDGERFAAWAARASEEALS
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atggccgccactccgccgaagcccgctgccgcgaccccgcgccgcaaggtgagccgtcac
cgcggcgagggccagtgggcggccgggcacttcaccccgctcaacggcaacgagcagacc
aagaaggacgacgacggtctcaacgttcggacacgtattgagacgatctactccaagcgc
ggcttcgactcgatcgaccccggcgacctgcgcggccgtatgcgctggtgggggctgtac
acccagcgtcgccagggcatcgacggcggcaagacggcgatcctcgagccggaggagctg
gacgaccgctacttcatgctccgcgtccgcatcgacggcggcgccctgaccacggctcag
ctgcgtgtcgtcggcgagatctcgcaggagttcgcgcgcggcacggccgacatcaccgac
cggcagaacgtccagtaccactggatccggatcgaggacgtgccggagatctggaaccgc
ctggagggcgtcggcctgtccacggtgaccgcctgcggtgacacgccccgcgtgatgatc
gcctcccccgtggcgggcatcgccgaggacgagatcatcgacggcacaccggcgctggag
gagatgaagcgccgggtcctgaacaacccggcgtactcgaacctcccccgcaagttcaag
accgcgatctccgggtcgccggtgcaggacgtcgtgcacgagatcaacgacgtggccttc
gtcggggtcgagcaccccgagcacggtccgggcttcgacctgtgggtgggcggcgggctg
tccaccaaccccaagctgggcgtgcggctgaacgcctgggtgccgatcgacgacgtgccc
gacgtctacgagggcgtcatctccatcttccgcgactacggctaccggcggctgcgcaac
cgcgcccgcctgaagttcctggtcgccgactggggcgcggagaagttccgtcaggtgctg
gaggacgagtacctgaagcggaagctgaccgacgggccggcacccgccgagcccagcagc
cgctggcgcgaccacatcggtgtgcaccgccagaaggacggccgctactacgtcggcttc
gccccgcgcgtgggccgcgtcgacggcaccatcctgaccaaggtcgccgacctggcggag
gcgcacggctcgggccgggtgcgcaccacggtcgagcagaagatgatcgtcctcgacgtc
gaggaggggcgggtcgactcgctggtggagtccctggaggcgctggacctcagcgccagg
ccctccaccttccggcgcggcaccatggcctgcacgggcatcgagttctgcaagctcgcc
atcgtcgagaccaaggcgcgcggcgcctcgctcatcgacgagctggagcgccgcctcccc
gacttcgacgagcccctcaccatcaatctcaacggctgcccgaacgcctgcgcccgcatc
cagaccgcggacatcggtctcaagggccagctcatgctcgacgagcacggcgagcaggtc
gagggctaccaggtgcacctgggcggcgccctcggcctggaggccggcttcgggcgcaag
gtgcgcggcctgaaggtcaccgcccaggaactgccggactacgtggagcgcgtcctcaag
cgcttccaggccgaacgcgaggacggcgagcgcttcgccgcctgggcggcccgggcctcc
gaggaggccctgtcgtga

DBGET integrated database retrieval system