KEGG   Streptomyces coelicolor: SCO6155Help
Entry
SCO6155           CDS       T00085                                 

Gene name
SC1A9.19
Definition
(RefSeq) pyruvate dehydrogenase
  KO
K00156  
pyruvate dehydrogenase (quinone) [EC:1.2.5.1]
Organism
sco  Streptomyces coelicolor
Pathway
Pyruvate metabolism
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SCO6155 (SC1A9.19)
Enzymes [BR:sco01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.5  With a quinone or similar compound as acceptor
    1.2.5.1  pyruvate dehydrogenase (quinone)
     SCO6155 (SC1A9.19)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
6756908..6758650
Genome map
AA seq 580 aa AA seqDB search
MAKQNVAEQFVDILTRAGVERLYGVVGDSLNPVVDAVRRHSGIEWVHVRHEETAAFAAGA
EAQITGKLTACAGSCGPGNLHLINGLYDAHRSMAPVLALASQIPSSEIGLGFFQETHPDQ
LFRECSHYSELISSPKQMPRLLQTAIQHAVGQGGVSVVSLPGDIADEPAPQGAAETALVT
SRPTVRPGDEEIDRLVRMIDDADKVTLFCGSGTAGAHAEVMEFAGKLKAPVGHALRGKEF
IQYDNPYDVGMSGLLGYGAAYEATHECDLLLLIGTDFPYNAFLPDDVKIAQIDVRPEHLG
RRSKLDLAVWGDARETLRCLIPRVKEKKNRRFLDRMLKKHADALEGVVKAYTRKVDKHVP
IHPEYVAALLDEMADDDAVFTVDTGMCNVWAARYISPNGRRRIIGSFSHGSMANALPMAI
GAQFTDRRRQVVSMSGDGGFTMLMGDFLTLVQHDLPVKIVLFNNSSLGMVELEMLVAGLP
SHGVANKNPDFAAVAEACGAFGVRVEKPKDLAGALKAAFKHKGPALVDVVTDPNALSIPP
KISADMVTGFALSASKIVLDGGVGRMLQMARSNLRNVPRP
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atggccaaacagaacgtcgcggaacagttcgtcgacatcctcacccgcgccggggtcgag
cgcctctacggagtcgtcggggacagcctcaaccccgtcgtggacgccgtgcgccgccat
tccggcatcgaatgggtgcacgtacggcacgaggagaccgccgccttcgccgccggggcg
gaggcgcagatcaccgggaagctcaccgcgtgcgccggctcctgcggccccggcaacctc
cacctcatcaacgggctctacgacgcccaccgctccatggcccccgtcctcgccctggcc
tcccagatcccgtccagcgagatcgggctcggcttcttccaggagacccaccccgaccag
ctgttccgcgagtgcagtcactacagcgagctgatctccagcccgaagcagatgccccgg
ctgctccagaccgccatccaacacgccgtcggccagggcggcgtcagcgtcgtctcgctg
cccggcgacatcgcggacgagcccgccccgcagggggccgccgagacggccctcgtcacc
tcccggcccaccgtccggcccggcgacgaggagatcgaccggctggtccggatgatcgac
gacgccgacaaggtcaccctgttctgcggcagcggcaccgcgggcgcgcacgccgaggtc
atggagttcgccgggaagctcaaggcaccggtcgggcacgccctgcggggcaaggagttc
atccagtacgacaacccgtacgacgtcggcatgagcggactgctcggctacggcgccgcc
tacgaggccacccacgagtgcgacctgctgctcctgatcggcaccgacttcccgtacaac
gccttcctcccggacgacgtgaagatcgcccagatcgacgtgcggcccgagcacctggga
cggcgctccaagctggacctcgcggtgtggggcgacgcgcgggagacgctgcgctgcctg
atcccccgggtcaaggagaagaagaaccgccgcttcctggaccggatgctgaagaagcac
gccgacgccctggaaggcgtcgtcaaggcgtacacccgcaaggtcgacaagcacgtcccg
atccaccccgagtacgtggccgccctgctggacgagatggccgacgacgacgcggtgttc
accgtcgacaccgggatgtgcaacgtctgggcggctcgttacatctcgcccaacgggcgc
cgccgcatcatcggttccttctcccacggttcgatggcgaacgcgctgccgatggcgatc
ggcgcccagttcaccgaccggcgccgacaggtcgtgtcgatgtccggcgacggcgggttc
accatgctgatgggcgacttcctcaccctcgtccagcacgacctgccggtgaagatcgtg
ctcttcaacaactcctcgctcggcatggtcgagttggagatgctcgtcgcgggcctgccc
tcgcacggggtggccaacaagaacccggacttcgccgccgtcgccgaggcctgcggcgcc
ttcggcgtccgggtggagaagcccaaggacctggccggggcgctgaaggcggcgttcaag
cacaagggtcccgccctcgtcgacgtggtcaccgaccccaacgccctgtccatcccgccg
aagatcagcgccgacatggtcaccggcttcgccctgtccgcctcgaagatcgtcctggac
ggcggggtcggacgcatgctccagatggcccggtcgaacctgcgcaacgtcccccgcccg
tga

DBGET integrated database retrieval system