KEGG   Streptomyces coelicolor: SCO6201Help
Entry
SCO6201           CDS       T00085                                 

Gene name
SC2G5.22
Definition
(RefSeq) glyoxylate carboligase
  KO
K01608  
tartronate-semialdehyde synthase [EC:4.1.1.47]
Organism
sco  Streptomyces coelicolor
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SCO6201 (SC2G5.22)
Enzymes [BR:sco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.47  tartronate-semialdehyde synthase
     SCO6201 (SC2G5.22)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Kitasato: 
UniProt: 
Position
6815497..6817281
Genome map
AA seq 594 aa AA seqDB search
MARMTAARAAVEILKREGVTDAFGVPGAAINPFYAALKASGGVQHTLARHVEGASHMAEG
YTRTHPGNIGVCIGTSGPAGTDMITGLYSAIGDSIPILCITGQAPTAVIHKEDFQAVDIA
SIAKPVTKMAVTVLEAAQVPGVFQQAFHLMRSGRPGPVLIDLPIDVQTTEIEFDPETYEP
LPVYRPAATRAQIEKAIGLLNAAERPLIVAGGGVINADAADLLVEFAELTGTPVVPTLMG
WGLLPDDHELNAGMVGLQTSHRYGNATFLESDFVLGIGNRWANRHTGKLDVYTAGRKFVH
VDVEPTQIGKIFAPDYGIASDAKAALKLFVEVARELKAAGRLPDRSAWAASAQERKATLQ
RRTHFDDIPIKPQRVYEEMNKAFGPETRYVSTIGLSQIAGAQMLHVYRPRHWINCGQAGP
LGWTVPAALGVAKADPDAQVVALSGDYDFQFMLEELAVGAQHRIPYVHVLVNNSYLGLIR
QAQRAFDIDFQVNLEFENINSPELGVYGVDHVKVAEGLGCKAIRVTDPNELGAALEQAKK
LAAEHRVPVVVEAILERVTNISMSGTNDISNVVEFEELATEPGHAPTAVRTLKV
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtatgaccgctgcccgagcggcagttgagatcctcaagcgcgagggcgtcacc
gacgcgttcggtgtgcccggtgcggcgatcaaccccttctacgcggcgctcaaggcgtcc
ggcggtgtgcagcacaccctcgcccgtcacgtcgagggcgcctcgcacatggccgagggc
tacacacgcacccaccccggcaacatcggcgtctgcatcggcacctcgggcccggccggc
accgacatgatcaccggtctctactcggcgatcggcgactcgatcccgatcctgtgcatc
accggccaggcaccgaccgccgtgatccacaaggaggacttccaggccgtcgacatcgcc
tccatcgccaagccggtgacgaagatggcggtcaccgtcctggaggccgcgcaggtcccc
ggggtattccagcaggcgttccacctgatgcgctccggccggcccggcccggtcctgatc
gacctgccgatcgacgtccagacgaccgagatcgagttcgacccggagacctacgagccg
ctcccggtctaccggcccgccgccacccgcgcccagatcgagaaggcgatcggcctgctc
aacgccgccgagcggccgctgatcgtggccggcggcggtgtcatcaacgccgacgcggcc
gacctgctcgtggagttcgccgagctgaccggcaccccggtcgtgccgaccctgatgggc
tggggcctgctgcccgacgaccacgagctgaacgccggcatggtcggcctccagacctcg
caccgctacggcaacgcgaccttcctggagtccgacttcgtcctcggcatcggcaaccgc
tgggccaaccgccacaccggcaagctggacgtctacaccgccgggcggaagttcgtccac
gtcgacgtcgagccgacccagatcggcaagatcttcgccccggactacggcatcgcctcc
gacgccaaggcggccctgaagctgttcgtcgaggtcgcgcgcgagctgaaggcggccggc
aggctgcccgaccgctccgcgtgggccgcctccgcgcaggagcgcaaggccaccctccag
cgccgtacgcacttcgacgacatcccgatcaagccgcagcgcgtctacgaggagatgaac
aaggccttcggaccggagacccggtacgtctccaccatcggcctctcccagatcgccggc
gcccagatgctgcacgtctaccggccgcggcactggatcaactgcggccaggccggcccg
ctcggctggaccgtcccggccgccctcggcgtcgccaaggccgacccggacgcccaggtc
gtggcgctctccggcgactacgacttccagttcatgctggaggagctggccgtcggcgcg
cagcaccggatcccgtacgtgcacgtcctggtgaacaactcctacctgggcctgatccgc
caggcgcagcgggcgttcgacatcgacttccaggtcaacctggagttcgagaacatcaac
tcgcccgagctgggcgtctacggcgtcgaccacgtcaaggtcgccgagggcctgggctgc
aaggcgatccgggtgaccgacccgaacgagctgggcgcggccctggagcaggccaagaag
ctggccgccgagcaccgggtgccggtcgtcgtcgaggcgatcctggagcgcgtcaccaac
atctccatgtcgggcaccaacgacatctccaacgtggtggagttcgaggagctggccacg
gagccggggcacgccccgaccgcggtcaggacgctgaaggtctga

DBGET integrated database retrieval system