KEGG   Streptomyces coelicolor: SCO6206Help
Entry
SCO6206           CDS       T00085                                 

Gene name
SC2G5.27c
Definition
(RefSeq) oxidoreductase
  KO
K01816  
hydroxypyruvate isomerase [EC:5.3.1.22]
Organism
sco  Streptomyces coelicolor
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SCO6206 (SC2G5.27c)
Enzymes [BR:sco01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.22  hydroxypyruvate isomerase
     SCO6206 (SC2G5.27c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
complement(6821469..6822308)
Genome map
AA seq 279 aa AA seqDB search
MGFADQRFNVNLSILFTELPLLERPAAAAAAGFTAVELWWPWIDSPTPEQSELDALKSAI
EDAGVQLTGLNFYAGQLPGPDRGALSIPGEESERFRANIDVAADFARSLGCTALNALYGN
RVEGVDPAEQDRLALENLVLAARAADRIGAVLLVEALNKPESPRYPLVSAPAAIAVVDRV
NEATGLGNAKFLMDLYHLSMNGEDLPQVIDAYAAKTGHVQIADNPGRGAPGTGSLPLEDL
LDRLAKAGYDGWVGLEYKPGDDPSAQSFSWLPAGARAAR
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgggattcgcagaccagcgcttcaacgtcaacctgtcgatcctcttcacggaactcccg
ctcctggagcgccccgcggccgccgccgcggccggcttcaccgcggtcgagctgtggtgg
ccctggatcgactcgcccacccccgagcagtccgagctggacgctctgaagtcggccatc
gaggacgcgggcgtccagctcaccgggctcaacttctacgccgggcagctgcccggaccc
gaccggggcgccctgtccatccccggcgaggagtcggagcgcttccgcgccaacatcgac
gtggccgccgacttcgccaggtcactgggctgcacggcactcaacgccctgtacggcaac
cgcgtcgagggcgtggacccggccgagcaggacaggctcgcgctggagaacctggtcctc
gcggcccgcgcggccgaccggatcggcgcggtcctgctggtcgaggcgctcaacaagccc
gagtcgccgcggtacccgctggtgtcggcgccggccgcgatcgcggtcgtggaccgggtc
aacgaggccaccgggctcggcaacgccaagttcctcatggacctctaccacctgtccatg
aacggcgaggacctgccgcaggtgatcgacgcgtacgccgcgaagaccggccatgtgcag
atcgccgacaacccgggccgcggcgcccccggtacgggctccctcccgctggaggacctg
ctcgaccgcctcgcgaaggccgggtacgacggctgggtcggcctggagtacaagcccggc
gacgaccccagcgcccagtccttctcctggctgccggccggggcccgcgcggcccgctga

DBGET integrated database retrieval system