KEGG   Streptomyces coelicolor: SCO6222Help
Entry
SCO6222           CDS       T00085                                 

Gene name
SC2H4.04c
Definition
(RefSeq) aminotransferase AlaT
  KO
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
sco  Streptomyces coelicolor
Pathway
Arginine biosynthesis
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    SCO6222 (SC2H4.04c)
   01230 Biosynthesis of amino acids
    SCO6222 (SC2H4.04c)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SCO6222 (SC2H4.04c)
   00290 Valine, leucine and isoleucine biosynthesis
    SCO6222 (SC2H4.04c)
   00220 Arginine biosynthesis
    SCO6222 (SC2H4.04c)
Enzymes [BR:sco01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     SCO6222 (SC2H4.04c)
    2.6.1.66  valine---pyruvate transaminase
     SCO6222 (SC2H4.04c)
Amino acid related enzymes [BR:sco01007]
 Aminotransferase (transaminase)
  Class I
   SCO6222 (SC2H4.04c)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
GeneDB: 
Kitasato: 
UniProt: 
Position
complement(6843172..6844380)
Genome map
AA seq 402 aa AA seqDB search
MEFRQSNKLSEVCYEIRGPVIEHANALEEAGHSVLRLNTGNPALFGFEAPEEIVQDMIRM
LPRAHGYTDSRGILSARRAVAQRYQALGLEVDVDDVFLGNGVSELISMAVQALLEDGDEV
LIPAPDFPLWTAVTTLAGGKAVHYLCDEQAEWYPDLADMEAKITDRTKAVVIINPNNPTG
AVYPKEIVEGILDLARRHGLMVLADEIYDQILYDDAVHHSAASLAPDLVVLTFCGLSKTY
RVAGFRSGWLVVTGPKQHARDYLEGLTMLASMRLCANAPAQYAIQAALGGRQSIRELTAP
GGRLHEQRDVAWEKLNEIPGISCVKPKGALYAFPRIDPAVHKIHDDERFVLDLLLREKIQ
VVQGTGFNWPSPDHFRILTLPHAEDLEAAIGRIGRFLSGYRQ
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggagttccggcagtcgaacaagctcagcgaggtctgttacgagatccgcggcccggtc
atcgagcacgccaacgcgctggaggaggcggggcacagcgtgctgcgcctgaacaccggc
aaccccgccctcttcgggttcgaggcgcccgaggagatcgtccaggacatgatccgcatg
ctgccgagggcgcacggctacacggactcgcgcggcatcctctccgcccgccgggccgtc
gcccagcgctaccaggcgctcggcctggaggtggacgtggacgacgtcttcctgggcaac
ggcgtctcggagctgatctccatggccgtgcaggccctccttgaggacggcgacgaggtg
ctgatccccgcccccgacttccccctctggacggcggtgaccaccctcgcgggcggcaag
gcggtgcactacctctgcgacgagcaggccgagtggtaccccgacctggccgacatggag
gcgaagatcaccgaccgcaccaaggcggtcgtcatcatcaaccccaacaaccccaccggc
gccgtctaccccaaggagatcgtcgagggcatcctcgacctcgcccgccggcacggcctg
atggtcctcgccgacgagatctacgaccagatcctgtacgacgacgccgtgcaccactcg
gccgcgtccctcgcccccgacctggtggtgctgaccttctgcggcctgtccaagacgtac
cgggtggcgggtttccgctccggctggctggtggtgacggggccgaagcagcacgcgagg
gactacctggagggcctgaccatgctggcctccatgcgcctgtgcgccaacgcgcccgcc
cagtacgccatccaggccgcgctcggcggccgccagtccatccgcgagctgacggccccc
ggcggacggctgcacgagcagcgggacgtcgcctgggagaagctcaacgagatccccggc
atctcctgcgtcaagcccaagggcgcgctgtacgccttcccgcgcatcgacccggccgtc
cacaagatccacgacgacgagcgcttcgtcctggacctgctgctgcgggagaagatccag
gtggtgcaggggacgggcttcaactggccctcccccgaccacttccgcatcctgaccctg
ccgcacgcggaggacctggaggccgcgatcggacgcatcgggcgcttcctgagcgggtac
cggcagtag

DBGET integrated database retrieval system