KEGG   Streptomyces coelicolor: SCO6247Help
Entry
SCO6247           CDS       T00085                                 

Gene name
SCAH10.12
Definition
(RefSeq) allantoinase
  KO
K01466  
allantoinase [EC:3.5.2.5]
Organism
sco  Streptomyces coelicolor
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
Purine degradation, xanthine => urea
Brite
KEGG Orthology (KO) [BR:sco00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SCO6247 (SCAH10.12)
Enzymes [BR:sco01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.5  allantoinase
     SCO6247 (SCAH10.12)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
6869725..6871062
Genome map
AA seq 445 aa AA seqDB search
MSEAELVLRSTRVITPEGTRAASVAVTGEKITAVLPYDAPVPAGARLEDVGDHVVLPGLV
DTHVHVNDPGRTEWEGFWTATRAAAAGGITTLVDMPLNSIPPTTTVDNLRTKREVAADKA
HIDVGFWGGALPDNVKDLRPLHEAGVFGFKAFLSPSGVDEFPHLDQEQLARSLAEIAAFD
GLLIVHAEDPHHLAAAPQQGGPKYTHFLASRPRDAEDTAIATLLAQAKRFNARVHVLHLS
SSDALPLIAEARADGVRVTVETCPHYLTLTAEEVPDGASEFKCCPPIREAANQDLLWQAL
ADGTIDCVVTDHSPSTADLKTDDFATAWGGIAGLQLSLPAMWTAARGRGLGLEDVVRWMS
ERTAALVGLDARKGAIAPGHDADFAVLAPDETFTVDPAALQHRNRVTAYAGKTLYGVVKS
TWLRGERIVADGAFTDPKGQLLDRA
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgaagctgaactggtgctgcgctcgacgcgcgtcatcactcccgaggggacccgc
gccgcgtccgtcgcggtcaccggggagaagatcacggccgtgctgccgtacgacgccccc
gtcccggcgggcgcccggctcgaggacgtgggcgaccacgtcgtcctgcccggcctggtc
gacacccatgtgcacgtgaacgaccccgggcgcaccgagtgggagggcttctggaccgcc
acccgtgccgcggccgccggcggcatcaccaccctcgtcgacatgccgctcaactccatt
ccgccgaccaccacggtcgacaacctgcgcaccaagcgcgaggtggccgccgacaaggcc
cacatcgacgtcggcttctggggcggcgccctgccggacaacgtcaaggacctgcgcccg
ctgcacgaggccggggtcttcggcttcaaggccttcctgtcgccgtccggcgtggacgag
ttcccgcacctcgaccaggagcagctcgcccggtcgctggcggagatcgccgccttcgac
ggcctgctgatcgtgcacgccgaggacccgcaccacctggccgccgccccgcagcagggc
ggccccaagtacacccacttcctcgccagccgcccgcgcgacgccgaggacaccgcgatc
gcgaccctgctcgcgcaggccaagcggttcaacgcgcgggtgcacgtgctgcacctgtcc
tccagcgacgccctgccgctgatcgccgaggcccgcgccgacggcgtgcgggtgacggtc
gagacctgcccgcactacctcacgctcaccgccgaggaagtgccggacggcgccagcgag
ttcaagtgctgcccgccgatccgcgaggcagccaaccaggacctgctctggcaggcgctg
gcggacggcacgatcgactgcgtcgtcaccgaccactccccgtccaccgccgacctcaag
accgacgacttcgccaccgcctggggcggcatcgccggactccagctcagcctgccggcc
atgtggaccgcggcgcgcgggcggggcctcggcctggaggacgtcgtgcgctggatgtcg
gagcgcacggccgccctggtggggctggacgcgcgcaagggcgccatcgcgccgggccac
gacgcggacttcgccgtgctggccccggacgagaccttcaccgtcgacccggccgccctc
cagcaccgcaaccgcgtcaccgcgtacgcgggcaagaccctgtacggcgtcgtgaagtcc
acctggctgcgcggcgagcgcatcgtggcggacggcgcgttcaccgacccgaagggacag
ctcctcgaccgggcctga

DBGET integrated database retrieval system