KEGG   Streptomyces coelicolor: SCO6284Help
Entry
SCO6284           CDS       T00085                                 

Gene name
SC1G7.10
Definition
(RefSeq) decarboxylase
Organism
sco  Streptomyces coelicolor
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Kitasato: 
UniProt: 
Position
6943673..6945265
Genome map
AA seq 530 aa AA seqDB search
MSTVEERPAGGSLPVTMDARVAELAELRERVLAGPSQRATEAQKGKGKLTVRERLELLFD
KGTFAETEAFRRHRATGFGLEDRKPHSDGVVTGWGQIDGRTVFAYAHDFRIFGGALGEAH
AQKIHKLMDLAETAGAPVVGLCDGAGARIQEGVTALAGYGGIFQRNVRNSGVIPQISVIM
GPCAGGAAYSPALTDFVFMVRGTSQMFITGPDVVQAVTGEQITQEGLGGADVHAGTSGVA
HFAYDDEEQCLEDVRHLLSYLPANNRELPPAEVPDDPADRRTEALLTLVPADPNRAYDMR
RVIEEIADHGEYFEVHERWAPNIICALTRLGGQVVGIVANQPQSMAGVLDIESSEKAARF
VQTCDSFNIPLVSLVDVPGFLPGVDQEHNGVIRHGAKLLYAYCNATVPRISLVLRKAYGG
AYIVMDSRSIGADIALAWPTNEIAVMGAEGAANVVFRREIAASDDPEAVRKARIDEYRDE
LMHPYYAAERGLVDDVVDPAETRSVLIGALRMLRDKHAPLPTRKHGNQPQ
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgtcgaggaacgaccggcgggcggttccctgcccgtgaccatggacgcgcgt
gtggcggagctggccgagctgcgcgagcgcgttctggccggtcccagccaacgtgcgacc
gaggcgcagaagggaaagggcaagctgaccgtacgcgagcggcttgaactcctcttcgac
aaggggacgttcgccgagaccgaggccttccgccggcaccgcgcgaccggcttcgggctg
gaggacaggaagccgcacagcgacggtgtcgtcaccgggtgggggcagatcgacggccgg
acggtcttcgcctacgcccacgacttccgcattttcggcggcgcgctcggcgaggcgcac
gcgcagaagatccacaaactgatggacctcgccgagaccgccggggcaccggtcgtcgga
ctctgcgacggcgccggcgcccgcatccaggagggcgtcaccgcgctcgccggctacggc
gggatcttccagcgcaacgtccgcaactccggcgtcatcccgcagatcagcgtgatcatg
ggcccctgtgccggcggcgcggcctactcgcccgccctgaccgacttcgtcttcatggtg
cgcggcacctcccagatgttcatcaccggaccggacgtcgtccaggcggtcaccggcgag
cagatcacccaggaggggctgggcggcgcggacgtgcacgccggcacgtccggcgtggcg
cacttcgcctacgacgacgaggagcagtgcctggaggacgtccggcacctgctgtcgtac
ctgcccgccaacaaccgcgaactcccgcccgccgaagtgccggacgacccggccgaccgg
cgcacggaggcgctgctgacgctggtgcccgccgaccccaaccgcgcgtacgacatgcga
cgggtcatcgaggagatcgccgaccacggcgagtacttcgaggtgcacgagcgctgggcg
cccaacatcatctgcgccctgacccggctgggcggacaggtcgtcggcatcgtcgccaac
caaccgcagtccatggccggtgtgctggacatcgagtcctcggagaaggccgcgcggttc
gtccagacgtgcgactcgttcaacatcccgctggtgagcctggtcgacgtacccggcttc
ctgcccggtgtcgaccaggagcacaacggcgtcatccggcacggcgcgaagctgctgtac
gcgtactgcaacgcgacggtcccgaggatctccctggtgctgcgcaaggcctacggcggc
gcgtacatcgtgatggactcccgctcgatcggcgcggacatcgccctggcctggccgacg
aacgagatcgcggtcatgggcgcggagggcgcggccaacgtggtcttccgccgggagatc
gcggcgtccgacgaccccgaggcggtgcgcaaggcccgcatcgacgaataccgcgacgag
ctcatgcacccgtactacgcggcggagcgcggtctcgtcgacgacgtcgtcgacccggcg
gagacccggtcggtactgatcggcgcgctgcgcatgctgcgcgacaagcacgcgccgctg
cccacccgcaagcacggcaaccagccccagtag

DBGET integrated database retrieval system